KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1500Help
Entry
Saci_1500         CDS       T00251                                 

Definition
ATP-dependent helicase
Orthology
K03724  
ATP-dependent helicase Lhr and Lhr-like helicase [EC:3.6.4.-]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Brite
Enzymes [BR:sai01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     Saci_1500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1278857..1281487
Genome map
AA seq 876 aa AA seqDB search
MDINTLLNTPDEDVLSLFTPQVARWFKEKYKVFTPPQKGAIPLIKKGKNVLVSSPTGSGK
TLAAFLGILDTLIDLGYKNELNKQIYAIYISPLRALNNDMRRNLIEPLTELRNLYPDLPE
ISIGVRTSDTSSYEKQKMLKKPPHILITTPESFGISLVSPKFREKLSDVKWVIVDEIHEL
ANSKRGAYLAGLLELYKSFIAKNNFVRIGLSATISPLEEVAKFLVGGNGDYEIIDARFVK
PTDIQVVSPVKDLVHATEEEVNIGIYSYLVDEIKKHKTTLIFTNTRHAAERVAYKLRKMF
EDQNIFDSDLVAAHHSSLSRDVRLEVEEKLKRGELKVVVSSTSLELGIDIGYIDLVTLLS
SPKSVSRLLQRVGRAGHHIREVSKGRVVVVDRDDLVECTVLAKLAIDRKIDNIHVPENPL
DVLTQLIVAASLITPIEKDKLYEIIKNVYNFRSLSYDEYNNVAEYLAGNYGLDSNKVYAK
IRIKDGMISPKRGTRMIFFLNSGTIPDEAMIPVKMENGGYVGNLEEEFVEILAPGDIFVL
AGKTYEFIRSEGNSVIVKKSEGQRPTVPSWFSEMLPLAFDSAIEIGKFRGKIAEAIMNEV
PKDEVISSIMSEYNLSRFAALSIYNYVKEELLFTGGIVPTDKLLLIEVYDDDDQNRNFIF
HGLYGRRTVDALSRAIAYIISKDLNMDVRIAITDNGFAITVPGKQEYEISKVFDKLEPDK
MYEILSDVILRTEMIKRRFRHCAERSFMLLKRYKGRETSIDRRQINSEVLLGVVRQIEHF
PVLKETVREILEDYMDIKRAIEIVEKIRNGDIKVATIGPNQVPSPFAHNILVKQYTDVVL
AEDKRELLKELHNKVIEFLRNKGIDIDLEYTEAGIK
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atggatattaataccttactcaacactcctgacgaagacgtattatccctttttactcca
caggtagcaagatggtttaaagaaaaatataaagtattcacccctcctcaaaaaggagct
atacctttaattaagaaaggaaaaaacgtcttagtttctagtccaacaggtagcggtaaa
acgctagcagcatttcttggaatcttagacacgctaatagacttaggctacaagaacgag
ttaaacaaacagatatacgcaatctacatatctcctttgagagcattaaacaacgatatg
agaaggaacttaatagagccacttacggagttgagaaacttatatccagatttaccagag
attagtataggagtaagaactagcgatacctcatcctatgagaaacaaaagatgctcaaa
aaaccaccgcacatccttattacaacaccagagtcatttggaatatcgttagtctcccct
aagtttagggagaaattgtcagatgttaaatgggttattgtggacgaaatacatgaatta
gctaatagtaagagaggagcatatttagcgggtttgttagagctgtataagtcattcata
gcaaaaaataatttcgtcagaatcggtttaagtgctacaatatcccctttagaggaagtg
gccaaatttttagttggtggaaatggcgattatgagattattgatgccagatttgtaaag
cctacagatattcaagtagtatcccctgtaaaagatttagtacatgctacagaggaagag
gttaatatcggaatatatagttatttggtagatgagataaagaaacacaaaactactctt
atcttcactaatactaggcacgcagctgaacgtgtagcttataagctcagaaaaatgttt
gaagatcaaaacatatttgacagtgatctagtggctgctcatcacagtagtttaagtaga
gatgtgaggttagaagttgaggagaaattgaaaagaggggaattgaaagttgttgtttca
tctactagtttagagctaggaatagacattggatatatagacctagtgactcttttaagt
agtccaaagagtgtaagtagattgttgcagagagtagggagggcaggacatcatattagg
gaagttagtaagggaagagttgttgttgtggatagggatgatttagtggagtgtacagtt
ttagccaagcttgctatagataggaagatcgataatatacatgttcctgagaatccatta
gatgttttaactcagttaatagttgcggcaagtttaataacgccaatagaaaaggacaag
ttatatgagatcataaagaacgtttataatttcagatctctaagttatgatgaatacaat
aatgttgctgaatacctagcagggaactacggacttgattctaataaagtatatgcaaag
attaggattaaggatggtatgatcagtccaaaaagaggtactaggatgattttcttctta
aatagtggtaccataccagacgaagcaatgatacctgtaaaaatggaaaatggagggtat
gtaggaaatttagaggaagagtttgtggagattctcgctcctggagatatattcgtctta
gctggtaagacgtatgagttcataagaagtgaaggaaactcagtaattgttaaaaaatct
gagggtcaaagacctactgttcccagctggttttctgaaatgttaccacttgcttttgat
tcggctattgaaataggtaaatttaggggcaaaatcgctgaggcaataatgaatgaggtg
cctaaggacgaggttatctcgagcatcatgtctgaatataatctttcacgatttgctgct
ctttcaatttataattatgtgaaggaagaactattattcactggtggtatagttcccact
gataaattactcctaatagaagtatacgacgatgatgatcagaataggaatttcatattt
catggtttatatggtcgtagaactgtagatgctctatctagagctatagcttatataata
agtaaagatcttaatatggacgtgagaatagcgataacagataacggatttgccataacc
gtacccggtaaacaagaatacgaaattagcaaagtttttgacaaattagaaccggataag
atgtatgagattctgagtgacgtgattctgagaactgaaatgatcaaaaggagatttaga
cactgtgccgaaagatcgtttatgcttctaaagagatataagggtagagaaaccagtatt
gacagaaggcaaataaattcagaggttctattgggagtagttaggcaaattgaacatttc
cctgtgttgaaagagacagtcagggaaattttagaggattatatggatataaaaagagct
attgaaatcgtagaaaaaatcagaaacggtgatataaaagtagcaactataggtcctaat
caagtcccaagtccatttgctcataacatattagtgaagcagtacactgatgtggtttta
gccgaagataaaagagagctactaaaagagcttcataataaggtcatagagttccttagg
aataagggaatcgatatcgatctcgagtacaccgaagctgggatcaaataa

DBGET integrated database retrieval system