KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1813Help
Entry
Saci_1813         CDS       T00251                                 

Definition
hypothetical protein
Organism
sai  Sulfolobus acidocaldarius DSM 639
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1580918..1581340
Genome map
AA seq 140 aa AA seqDB search
MTEYLFDASSIVNLIKRGIVSPLTNGETLNLALYECISAIWKEYRKLKVISRDLAGKYIR
AIIKVMSIIPVNSISGSEEEVFDLALKEDLTIYDASYLLVAINKNLMLVTDDKVLRDRAS
KYVTATSTKELLTRYGFVDQ
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgagtacctctttgacgcaagttcaatcgtaaaccttataaaaaggggcatcgtc
tcgccattaactaacggagagacgttaaacttagcactatatgagtgcataagtgccata
tggaaggaatatcgtaaactaaaagtaattagtagggatttagcgggaaaatacataaga
gcgataataaaggtgatgagcataatacccgtaaattccatcagtggatcagaagaggaa
gtatttgatttagcattgaaggaggatttgacaatctatgatgcctcttatttgctagtt
gccataaataagaacctcatgttagtaacggatgataaggtgttgagagatagggcatca
aagtacgtaactgctacgagtacaaaggaacttcttaccagatacggattcgttgaccaa
tga

DBGET integrated database retrieval system