KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1881Help
Entry
Saci_1881         CDS       T00251                                 

Definition
(RefSeq) hypothetical protein
  KO
K15342  
CRISP-associated protein Cas1
Organism
sai  Sulfolobus acidocaldarius DSM 639
Brite
DNA repair and recombination proteins [BR:sai03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factor
     Saci_1881
Prokaryotic defense system [BR:sai02048]
 CRISPR-Cas system
  Universal Cas proteins
   Saci_1881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1669823..1670740)
Genome map
AA seq 305 aa AA seqDB search
MSILVIKNATIMRKGSDLQMTWSVGKNLTVSSLDLELVVIVGNNVRLTSEVILFLSSLNI
PVLVHGKRNDVVLVSPFLNSLVNVRRKFYTLSDDMKLYLARKFIKGKILGMINVAKYFMY
LTKVPVEIDLELKQIDNTKSIDELRSVEAEMSKACWEQLRKFLPPSFTGRKPRNEDEINR
AVDYAYSVIYALCTHSLIASGLDPYGGLMHVEYPGRTALTYDFSEMFKPVAIHSVIAVSR
KVKLKLDNSGYLSKESLGHLTKHLYETLHKGKRSVRGQIYSMGMKTKNFIAEGIDFEPFV
YKPKQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtccattctagtgattaaaaacgctacaattatgaggaaaggctcagatcttcagatg
acatggtccgttggaaagaacttaactgtgtctagtctggacctagagttagtggtcatt
gtcggtaataatgttaggctaacatcagaggtgatcttgttcctttccagtctaaatata
ccagttctcgtccacggaaagagaaacgatgtggtcctagtgtcgccgttcttgaactct
ttagtgaacgtgaggaggaagttttatactctaagtgatgatatgaaattatatttagcc
aggaagttcataaagggtaaaatattaggaatgataaacgtggcaaagtactttatgtac
cttacgaaagtcccagtggagattgaccttgagttgaaacagatcgacaatacgaaatcg
atagatgagctgaggtcagtagaggctgagatgagtaaggcgtgctgggagcaactgagg
aaattcttacctccctcttttaccgggaggaagcctagaaatgaggatgagataaacagg
gcagtggactatgcgtactcggtgatttacgccctatgtactcactccctgatagcctct
ggtctcgatccctatggagggttgatgcatgtggagtacccaggaaggacagcgttaacc
tatgatttctctgagatgtttaagcctgttgcaatacactcagtgattgctgtcagtaga
aaggtgaagcttaaactagacaactcaggttacctgtctaaagagtcgttagggcacttg
acgaagcacttatatgagaccttacacaaggggaaaaggagtgtgaggggacaaatttac
tccatggggatgaagactaagaactttattgcagagggtattgattttgagccattcgta
tacaaacctaagcaataa

DBGET integrated database retrieval system