KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1893Help
Entry
Saci_1893         CDS       T00251                                 

Definition
hypothetical protein
Organism
sai  Sulfolobus acidocaldarius DSM 639
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1687155..1688339
Genome map
AA seq 394 aa AA seqDB search
MIKVIPVLIKTMSITRIGSTGVYFDYASADIVTYKLPLQDSNEVYYIPAIPATSFKGLLR
STYEKYLRWNNVGYQRREVKKERIKNIINEYSVNHGDTVKELVEEMKSELRRYISGGLIK
NTNLPDDITELIILYLNVTGWNSKDACYVTSDLDQCVNLSIIEDEGVRKKKELWLKLMER
DQICKVCNVLGSSGVRGKVKFTDLIAVDPFPVYIERSTHIAINRLTGTAEKGKIFTEEII
PPGVKFLGFVAVLDNSILNQVREMLRILKTKAERGEVWIGGRGTAGYGTFEMHLPPEIIE
FSTHSLFRGRRLGLKESEPAPNPTIVNGIISKLYPSSFTSSLVEVTEGEVEYEVVIEGEG
VTKVKSVDDLKKITSELDKSGKKYQIKTHGEYHL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
ttgattaaggtcatacctgtattaataaaaaccatgtcgataactaggataggatctacg
ggtgtatattttgactacgcctctgctgatatagtaacttataaattgccccttcaagat
tctaacgaagtttactatattccagcaatacctgcgacatcttttaaaggtttactgagg
tcaacatatgagaaatacctaagatggaataatgtaggttatcagaggagagaggttaag
aaagaacgaatcaagaatataattaatgaatatagtgttaatcatggcgatacggttaag
gaactggttgaggaaatgaagagcgaactacggaggtatatatcgggtgggctgattaaa
aacacaaatcttcctgacgacattacagagctaattatactctacttaaacgtaactggt
tggaacagtaaggacgcatgttacgtaacttcagacctagaccaatgtgttaatttaagt
attatagaagacgaaggtgtgagaaaaaagaaagagttgtggttaaagcttatggagaga
gaccaaatatgtaaggtgtgtaatgttttaggtagttcaggggtaaggggaaaagtcaag
tttacggacttaatagctgtggacccattccctgtgtatatcgagagaagtactcatata
gccataaatagattgacaggtactgcagaaaaagggaagatcttcacggaagagataata
cctccgggtgttaaattcttgggttttgttgcagtgctagataactctatcctcaaccag
gttagggagatgttaagaatactaaagaccaaggcagagaggggagaggtctggatagga
ggtaggggtacagctgggtacggtacctttgagatgcacctcccacctgagataattgag
ttttcaacacactccttatttaggggtagacgtttagggttaaaggagagtgagccagct
cctaatccgactatagttaatggtatcattagtaagctatacccgagtagttttacttct
tcgttggtagaggtcactgagggtgaggtagagtacgaggtggttattgaaggtgaagga
gtaactaaggttaaatctgttgatgatttaaagaaaattacaagtgagcttgataaatct
ggtaaaaagtaccaaataaaaacacatggtgaatatcacctatga

DBGET integrated database retrieval system