KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1949Help
Entry
Saci_1949         CDS       T00251                                 

Definition
hypothetical protein
Organism
sai  Sulfolobus acidocaldarius DSM 639
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1762556..1763086
Genome map
AA seq 176 aa AA seqDB search
MEIIKFPNVKDRKGYARNRVLESLFEVRLSIKMLKDGYSRNSANKIFLAWKAFISALVTL
NLDKLGKDEKQKEWYNKIGFCAPTTGIKGITQELEDLGYKDLSNVTSTALLLHSYAYNGI
YKGITNYSSKEEAIRDIIKLTKFILDNITSFKDIWDNELEEEYTKSLNEFKELLSK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
gtggaaataataaaatttcctaacgtaaaagacagaaagggttatgcacgtaatagagtc
cttgaatcgttgttcgaggttagactatcaataaagatgctgaaggatgggtattcaaga
aattcggctaataagattttcttggcatggaaggcattcattagtgctttagtaacgcta
aacctagataaattaggtaaagatgaaaagcaaaaggagtggtacaataagataggtttt
tgcgctccaaccacgggtataaagggaataacgcaagagttggaggatttgggatacaag
gacctatcaaatgtaacttcaactgcactccttctacactcctatgcttataacggaata
tataagggcattaccaactattcttcaaaggaagaggcgataagggatatcataaaatta
actaagtttattttagacaacatcacttcttttaaagacatatgggataacgagctggaa
gaggaatacacaaagagcctgaacgagtttaaggagttattgagcaaataa

DBGET integrated database retrieval system