KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1951Help
Entry
Saci_1951         CDS       T00251                                 

Definition
hypothetical protein
Organism
sai  Sulfolobus acidocaldarius DSM 639
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1764611..1764859
Genome map
AA seq 82 aa AA seqDB search
MCPSLSTHIPESQGGWSEGSYTQGIWVKWAKTSPVVYRWTSGAGWVLNASTSYEAMRVKA
VNHKLMNRPKGTLAIYGGEEVS
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgtgtccctccctctcaacacatatccccgagtcccaaggagggtggagtgagggctcc
tacacccaagggatatgggtaaagtgggctaagaccagcccagtggtctaccgctggacg
agtggagcggggtgggtgcttaatgcatccactagctatgaagcgatgagagtgaaggcg
gtaaaccataaactaatgaaccgtcctaagggaaccctcgccatttatggcggggaggag
gtcagctag

DBGET integrated database retrieval system