KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1954Help
Entry
Saci_1954         CDS       T00251                                 

Definition
(GenBank) conserved Archaeal PIN domain protein
  KO
K07064  uncharacterized protein
Organism
sai  Sulfolobus acidocaldarius DSM 639
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIN PIN_4
Motif
Other DBs
NCBI-ProteinID: AAY81257
UniProt: Q4J7H4
Position
complement(1766204..1766599)
Genome map
AA seq 131 aa AA seqDB search
MKILVDTNVLIYDLVENSKFHKEAEDILDRAETWVIPSVVVHELVWFLRANNLERMDYVS
AYVESPKAEIVCEDFDVLKNAMEIILREKISLSRYNDPVILSHAILRKLPLSTFDRRLSN
LAKRYGIDIVK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttagttgatactaacgtactaatctatgacctcgtggagaactcaaagttt
cacaaggaagctgaggatatattggacagagcagaaacttgggtcataccttctgtagtc
gttcatgagctagtatggttcttgagggcgaataacctggagagaatggactacgtatca
gcatatgtggaaagccccaaggctgaaatagtgtgcgaggactttgatgttttaaagaac
gcaatggaaataatactgagggaaaagatatctctttctaggtataatgacccagtaata
ctctcacacgcgattctcaggaagttaccactttcgacgtttgataggagactctccaac
ttggcaaagaggtacggaatagacatagttaagtga

DBGET integrated database retrieval system