KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1954Help
Entry
Saci_1954         CDS       T00251                                 

Definition
PIN domain-containing protein
Orthology
K07064  
 
Organism
sai  Sulfolobus acidocaldarius DSM 639
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1766204..1766599)
Genome map
AA seq 131 aa AA seqDB search
MKILVDTNVLIYDLVENSKFHKEAEDILDRAETWVIPSVVVHELVWFLRANNLERMDYVS
AYVESPKAEIVCEDFDVLKNAMEIILREKISLSRYNDPVILSHAILRKLPLSTFDRRLSN
LAKRYGIDIVK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttagttgatactaacgtactaatctatgacctcgtggagaactcaaagttt
cacaaggaagctgaggatatattggacagagcagaaacttgggtcataccttctgtagtc
gttcatgagctagtatggttcttgagggcgaataacctggagagaatggactacgtatca
gcatatgtggaaagccccaaggctgaaatagtgtgcgaggactttgatgttttaaagaac
gcaatggaaataatactgagggaaaagatatctctttctaggtataatgacccagtaata
ctctcacacgcgattctcaggaagttaccactttcgacgtttgataggagactctccaac
ttggcaaagaggtacggaatagacatagttaagtga

DBGET integrated database retrieval system