KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1981Help
Entry
Saci_1981         CDS       T00251                                 

Definition
(GenBank) conserved Archaeal protein
Organism
sai  Sulfolobus acidocaldarius DSM 639
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1795579..1795983
Genome map
AA seq 134 aa AA seqDB search
MRIVDASALTALVLKEEGWDDILKFFTPAHSIEHVVKETMNAIWRMKNVKKLIDDKTAFG
MKRVLFELLNERTLLLLNEMEYVENAFEIAMNNNLTFYDSLYIAACLKHSAQLITRDDKQ
ARVAEKLGVEVVMP
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcggatagttgacgcctcagccctcaccgctttagtgttgaaagaagagggatgggat
gatatcttaaagtttttcacaccagcccattccatagaacacgtggtaaaggagacaatg
aacgctatatggagaatgaaaaatgtcaaaaagctaatagacgataagactgcctttgga
atgaaaagggtgttgtttgaactattaaatgagaggacattactgctcctaaacgagatg
gaatacgtcgagaacgcgtttgaaattgcaatgaacaataacctcacgttttacgattct
ctctacatagctgcatgtttaaagcacagtgctcaactgataacgagagatgacaaacag
gctagagttgcagagaagctaggtgtcgaggtagtcatgccctga

DBGET integrated database retrieval system