KEGG   Sulfolobus acidocaldarius DSM 639: Saci_2145Help
Entry
Saci_2145         CDS       T00251                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K14465  
succinate semialdehyde reductase (NADPH) [EC:1.1.1.-]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Carbon fixation pathways in prokaryotes
Microbial metabolism in diverse environments
Carbon metabolism
Module
Dicarboxylate-hydroxybutyrate cycle
Hydroxypropionate-hydroxybutylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sai01200]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sai00720]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1974724..1975815
Genome map
AA seq 363 aa AA seqDB search
MLAGVLHNYKEPITVEEVEIEEPKENEVMIEVKATGMCHSDVNVFLGSTPVPTPVIAGHE
IAGRVVKVGHNVSRVKEGDRVISTFIQPCGKCKNCISGMENLCETFASVRLKGTMFDGTT
RVKYKDGRSIRTFLGGGFAEYSIVHENALTRMEDSNVNIEELAVLGCSGITAYGAISSAN
VRPGDSVAVVGVGGVGLSVIQMLRAVGAGRIIALGTKKWKLEKALELGATDFINTKESEP
VKTLKEMTNGGPDIIIEAGGTQETIQMALEGVRIGGKVVLIGLPPTSALIPVRVSMIVRN
GITIIGNYGSKPRVDMPKLVELVRTKRYDPQKLITGKFKLEEINEAVKLLEEGLAIRSLI
IPH
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgctagcaggagtgcttcataactataaggaacctataactgtggaggaagtggaaata
gaggagcctaaggaaaatgaggtaatgatcgaggttaaggctactggaatgtgccactct
gatgtaaatgtttttttagggtcaactcccgtccctacgcctgtaatagcaggacatgaa
atagcaggcagagttgtgaaggtggggcataatgtaagtagggtaaaagaaggcgatagg
gttatatcaactttcattcaaccctgcggaaagtgtaagaattgtatatctggtatggaa
aatctttgtgagacttttgcatcggtcagactgaaaggtacaatgtttgacggtacaact
agagttaaatataaggacggaaggtctataaggacatttttaggtggagggtttgcggaa
tattctatagtgcacgaaaatgccttaactagaatggaagacagcaacgtgaatatagag
gaactagctgtgttaggatgttctggtataactgcttatggtgcaattagctctgccaac
gtaagacctggggatagtgtagctgtagtaggagtaggtggtgttgggctatcagttata
caaatgctgagagcagtgggggcagggagaataattgctctaggaacaaagaagtggaaa
ttggaaaaagctctagagcttggggcaacagattttataaacaccaaggaatctgagcca
gtaaaaaccctgaaggaaatgactaatggaggtccagatataataattgaggctggggga
acccaagagactatacaaatggctttagaaggggttagaattggagggaaagtggttttg
ataggcttaccacctacatcagctctcattccagttagagtctcaatgatagtgagaaat
ggaatcactataataggtaattatggcagtaaacctagggtagatatgccgaaactagta
gagttagttaggacaaagagatacgacccacagaaactcattacaggaaaattcaagtta
gaggaaatcaacgaggctgtgaaattgttagaggaggggctcgcaataaggagtttaatt
attcctcactag

DBGET integrated database retrieval system