KEGG   Sulfolobus acidocaldarius DSM 639: Saci_2145Help
Entry
Saci_2145         CDS       T00251                                 

Gene name
adh
Definition
(GenBank) conserved alcohol dehydrogenase
  KO
K14465  succinate semialdehyde reductase (NADPH) [EC:1.1.1.-]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
sai00720  Carbon fixation pathways in prokaryotes
sai01120  Microbial metabolism in diverse environments
sai01200  Carbon metabolism
Module
sai_M00375  Hydroxypropionate-hydroxybutylate cycle
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saci_2145 (adh)
Enzymes [BR:sai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Saci_2145 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C Sacchrp_dh_NADP ThiF
Motif
Other DBs
NCBI-ProteinID: AAY81438
UniProt: Q4J6Z3
Position
1974724..1975815
Genome map
AA seq 363 aa AA seqDB search
MLAGVLHNYKEPITVEEVEIEEPKENEVMIEVKATGMCHSDVNVFLGSTPVPTPVIAGHE
IAGRVVKVGHNVSRVKEGDRVISTFIQPCGKCKNCISGMENLCETFASVRLKGTMFDGTT
RVKYKDGRSIRTFLGGGFAEYSIVHENALTRMEDSNVNIEELAVLGCSGITAYGAISSAN
VRPGDSVAVVGVGGVGLSVIQMLRAVGAGRIIALGTKKWKLEKALELGATDFINTKESEP
VKTLKEMTNGGPDIIIEAGGTQETIQMALEGVRIGGKVVLIGLPPTSALIPVRVSMIVRN
GITIIGNYGSKPRVDMPKLVELVRTKRYDPQKLITGKFKLEEINEAVKLLEEGLAIRSLI
IPH
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgctagcaggagtgcttcataactataaggaacctataactgtggaggaagtggaaata
gaggagcctaaggaaaatgaggtaatgatcgaggttaaggctactggaatgtgccactct
gatgtaaatgtttttttagggtcaactcccgtccctacgcctgtaatagcaggacatgaa
atagcaggcagagttgtgaaggtggggcataatgtaagtagggtaaaagaaggcgatagg
gttatatcaactttcattcaaccctgcggaaagtgtaagaattgtatatctggtatggaa
aatctttgtgagacttttgcatcggtcagactgaaaggtacaatgtttgacggtacaact
agagttaaatataaggacggaaggtctataaggacatttttaggtggagggtttgcggaa
tattctatagtgcacgaaaatgccttaactagaatggaagacagcaacgtgaatatagag
gaactagctgtgttaggatgttctggtataactgcttatggtgcaattagctctgccaac
gtaagacctggggatagtgtagctgtagtaggagtaggtggtgttgggctatcagttata
caaatgctgagagcagtgggggcagggagaataattgctctaggaacaaagaagtggaaa
ttggaaaaagctctagagcttggggcaacagattttataaacaccaaggaatctgagcca
gtaaaaaccctgaaggaaatgactaatggaggtccagatataataattgaggctggggga
acccaagagactatacaaatggctttagaaggggttagaattggagggaaagtggttttg
ataggcttaccacctacatcagctctcattccagttagagtctcaatgatagtgagaaat
ggaatcactataataggtaattatggcagtaaacctagggtagatatgccgaaactagta
gagttagttaggacaaagagatacgacccacagaaactcattacaggaaaattcaagtta
gaggaaatcaacgaggctgtgaaattgttagaggaggggctcgcaataaggagtttaatt
attcctcactag

DBGET integrated database retrieval system