KEGG   Sulfolobus acidocaldarius DSM 639: Saci_2193Help
Entry
Saci_2193         CDS       T00251                                 

Definition
hypothetical protein
Organism
sai  Sulfolobus acidocaldarius DSM 639
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2032646..2032906)
Genome map
AA seq 86 aa AA seqDB search
MLISKIYQNDHMAKVLRVGKKYAIYIPKDIVEEMKIKEGDLLMVTREGDKITLVPLRKPT
GYWAEIDADEVEKVGEEITRSFRING
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgcttattagtaagatttaccagaatgatcacatggcaaaagttctaagagtggggaag
aaatatgcaatatacatacctaaagatatcgttgaagaaatgaagataaaggagggagat
ttattaatggttacaagagaaggcgataaaattaccttagttccccttaggaagccaacg
ggatattgggcagaaatagacgctgatgaggtagaaaaggttggagaagaaattactaga
tcattcagaattaatggttga

DBGET integrated database retrieval system