KEGG   Sulfolobus acidocaldarius DSM 639: Saci_2224Help
Entry
Saci_2224         CDS       T00251                                 

Gene name
adh
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:sai01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sai00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:sai00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:sai00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:sai00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:sai00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2066295..2067353
Genome map
AA seq 352 aa AA seqDB search
MKAAIFKGANAPLQLTDIPKPSPGEGEILIRVASTGVCHSDIHHMKGELLGFMPPEGFIL
GHEISGWVEDFGPNVTNPYGLQKGDPVIVSWIVPCGKCRYCASGKENYCNNVMMKMPGLI
GINGGHAEYTSVPEIAVIPAREIKDVIASSPVSCAYGTAYGALKTAGASAGQSVVVIGTG
GVGSAAIQLASVMGLYPIIAVDVVDSKLAKVKELGATHTVNPNKEDPVGKITEILPEGAD
IVYETKPNPDLQIAFNVVNKSGTMVVTGLGNATSSTINLMTNLFVGRGLKVVGSLGYRPR
IDLPELVRMVASGKLDVKKLVTHVYRPDEINTAYENLEKGLHLRAIIDWTKL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcaatatttaagggagcaaacgcaccgcttcaattaacggatatccctaaa
ccgtccccaggtgaaggagagatcctaattagagtagcatctacaggtgtttgccattcc
gatatacaccacatgaaaggtgagctacttggatttatgccacccgaggggtttattctt
ggacatgaaatttcaggatgggtagaagattttggaccgaatgtaacaaacccctatgga
ctacaaaaaggagaccctgtaatagtatcatggattgtaccatgtggaaagtgtagatat
tgtgcgtctggtaaggaaaactattgtaacaacgtaatgatgaagatgccgggtttgatc
ggaataaatgggggtcatgctgaatacacttcagtccctgaaatagctgtaataccggca
agagaaataaaagatgtgattgcctcttcacctgtttcatgtgcatatggtacagcttac
ggagcacttaagactgctggtgcttctgcaggtcaaagtgtagttgtaataggtacaggt
ggtgtaggttccgctgcgattcagttagccagtgtaatggggctatatccaataattgca
gtggatgttgtagacagtaaattagcgaaagtaaaagaattgggagcgactcatactgtt
aatcctaacaaggaagaccctgttggcaagataactgagatattaccagaaggagcggat
atagtttatgagactaaacccaatccagatttgcaaatagcctttaacgtcgtgaacaag
tcgggaacaatggttgttaccggactagggaatgccacatcaagtacaattaacttaatg
actaacctctttgtgggaaggggacttaaagttgtgggaagtttaggttatagacccagg
attgacttaccagagttggtaaggatggtagcatcgggtaagctcgacgttaaaaaactt
gtgactcacgtgtatagaccagatgagataaacactgcatacgaaaatcttgagaaagga
ctgcatttaagagcaataattgactggactaagctgtag

DBGET integrated database retrieval system