KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0117Help
Entry
Saci_0117         CDS       T00251                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saci_0117 (tpiA)
   01230 Biosynthesis of amino acids
    Saci_0117 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saci_0117 (tpiA)
   00051 Fructose and mannose metabolism
    Saci_0117 (tpiA)
   00562 Inositol phosphate metabolism
    Saci_0117 (tpiA)
Enzymes [BR:sai01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Saci_0117 (tpiA)
Exosome [BR:sai04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Saci_0117 (tpiA)
  Exosomal proteins of bladder cancer cells
   Saci_0117 (tpiA)
  Exosomal proteins of melanoma cells
   Saci_0117 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(86487..87179)
Genome map
AA seq 230 aa AA seqDB search
MKPPVILINYKAYENSYGKKSIEITKKIEKVSKEYGTEIIVSVPATMIHRISEESELTVF
AQHVDSGEQGARTGAILPEMIKDAGARGSLLNHSERRIRLDEMAESLERIRVLNLESVVC
VDRYELVLPVALLRPNAVLIEPPELIGTGIPVSKAKPEAITKAVEEIKKTKDVYLLAGAG
ITTGEDVFKAIELGADGIGAASAVMKAKEPEKVVEDFVKNAIKAMEKRGE
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgcctgttattttaattaattataaagcttatgaaaattcttatggcaagaaa
tctatcgaaataacaaagaaaatagaaaaagtaagcaaagaatatggaaccgaaataata
gtttccgtcccagctacaatgatacaccgtataagtgaggaatctgaattgactgtattt
gcccagcatgttgatagtggagaacagggtgctagaacaggagccatattacctgaaatg
ataaaggatgctggcgccagaggatctctgcttaaccatagcgagagaagaataagatta
gacgaaatggctgaatcgttagagagaatcagagtactgaatttagagagtgtagtatgc
gtggacagatatgaattagttttgcccgtcgcgttgctgagacctaacgctgtattaata
gagcctccagaactaataggaacaggtattcccgtgtcaaaggctaaacctgaagccata
actaaggctgtggaggaaattaagaaaactaaagatgtttacctattagcaggagccgga
ataacaacaggagaagatgtctttaaggctatagaattgggtgctgatggtataggtgca
gctagtgcagtgatgaaagcaaaggagcctgaaaaagtagtagaggactttgtgaagaac
gctataaaagcaatggagaaaagaggagaataa

DBGET integrated database retrieval system