KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0208Help
Entry
Saci_0208         CDS       T00251                                 

Gene name
korB
Definition
2-oxoglutarate ferredoxin oxidoreductase subunit beta (EC:1.2.7.3)
Orthology
K00175  
2-oxoglutarate ferredoxin oxidoreductase subunit beta [EC:1.2.7.3]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saci_0208 (korB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Saci_0208 (korB)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saci_0208 (korB)
Enzymes [BR:sai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.3  2-oxoglutarate synthase
     Saci_0208 (korB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(169751..170665)
Genome map
AA seq 304 aa AA seqDB search
MAGHKFHWNDWCPGCGNFGILSAEQQAITELGITKNTVIVGGIGCSGKLSQYTRIPVSGV
HTLHGRAIPFAVGIKLANPSLEVIVNGGDGDLLGIGAGHFVSVGRRNVDIVVILHNNGVY
GLTKGQAAPTLFRGMKTKSLPRPNINDAINPVTLALASGYTFVARAYAYDVPHLKEIIKQ
AIKHKGLAFVDILQPCPTYNDINTKEWYDKRVYKMQDMDPVVKSESEMQEKLKKAIDKSY
EWGERIPIGIFYKNELVPTYEERIKTSAPSYYDNYPAEQKIEYEKKLTTIIDPLLEERKV
SEDN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggtcataagttccattggaatgattggtgcccaggctgtggaaacttcggaata
ctaagtgcagagcaacaagcgataacagaacttgggataacaaagaacactgtgatagtg
ggaggaataggttgttcaggcaaactctcacaatatacaaggatacctgttagtggagtt
cacacattacacggtagagcgataccgtttgcagtaggtataaagctagctaatccatcc
cttgaggttattgtaaatggaggagacggtgacctactaggaattggtgctggtcatttc
gtatcagttggaaggagaaatgtggacattgtggtaatccttcacaataacggagtttat
ggtttgacaaaaggtcaagcagctcctacactatttaggggaatgaagaccaaatcatta
ccaagaccaaatataaatgacgcaataaacccagttacattagccttagcctctggttac
actttcgttgcaagagcctatgcctacgatgtgccacacctaaaggagattataaaacag
gctataaaacacaagggattagccttcgtagatatacttcaaccatgtcccacttataat
gacataaacaccaaggaatggtatgataaaagagtgtataagatgcaagatatggaccca
gtagtgaaatcagagagtgagatgcaggagaagttgaagaaagctatagataaaagctat
gagtggggagagagaattccaattggaatattctacaagaatgagttagtaccaacctat
gaggaaagaataaagacaagtgcaccatcttactatgacaactaccctgctgagcagaaa
attgaatatgaaaagaaattgaccacaatcatagacccactattggaagagagaaaggta
tctgaggacaattag

DBGET integrated database retrieval system