KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0208Help
Entry
Saci_0208         CDS       T00251                                 

Gene name
korB
Definition
(GenBank) 2-oxoglutarate synthase subunit B (EC:1.2.7.3)
  KO
K00175  
2-oxoglutarate/2-oxoacid ferredoxin oxidoreductase subunit beta [EC:1.2.7.3 1.2.7.11]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saci_0208 (korB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saci_0208 (korB)
   00020 Citrate cycle (TCA cycle)
    Saci_0208 (korB)
   00620 Pyruvate metabolism
    Saci_0208 (korB)
   00650 Butanoate metabolism
    Saci_0208 (korB)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saci_0208 (korB)
Enzymes [BR:sai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.3  2-oxoglutarate synthase
     Saci_0208 (korB)
    1.2.7.11  2-oxoacid oxidoreductase (ferredoxin)
     Saci_0208 (korB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(169751..170665)
Genome map
AA seq 304 aa AA seqDB search
MAGHKFHWNDWCPGCGNFGILSAEQQAITELGITKNTVIVGGIGCSGKLSQYTRIPVSGV
HTLHGRAIPFAVGIKLANPSLEVIVNGGDGDLLGIGAGHFVSVGRRNVDIVVILHNNGVY
GLTKGQAAPTLFRGMKTKSLPRPNINDAINPVTLALASGYTFVARAYAYDVPHLKEIIKQ
AIKHKGLAFVDILQPCPTYNDINTKEWYDKRVYKMQDMDPVVKSESEMQEKLKKAIDKSY
EWGERIPIGIFYKNELVPTYEERIKTSAPSYYDNYPAEQKIEYEKKLTTIIDPLLEERKV
SEDN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggtcataagttccattggaatgattggtgcccaggctgtggaaacttcggaata
ctaagtgcagagcaacaagcgataacagaacttgggataacaaagaacactgtgatagtg
ggaggaataggttgttcaggcaaactctcacaatatacaaggatacctgttagtggagtt
cacacattacacggtagagcgataccgtttgcagtaggtataaagctagctaatccatcc
cttgaggttattgtaaatggaggagacggtgacctactaggaattggtgctggtcatttc
gtatcagttggaaggagaaatgtggacattgtggtaatccttcacaataacggagtttat
ggtttgacaaaaggtcaagcagctcctacactatttaggggaatgaagaccaaatcatta
ccaagaccaaatataaatgacgcaataaacccagttacattagccttagcctctggttac
actttcgttgcaagagcctatgcctacgatgtgccacacctaaaggagattataaaacag
gctataaaacacaagggattagccttcgtagatatacttcaaccatgtcccacttataat
gacataaacaccaaggaatggtatgataaaagagtgtataagatgcaagatatggaccca
gtagtgaaatcagagagtgagatgcaggagaagttgaagaaagctatagataaaagctat
gagtggggagagagaattccaattggaatattctacaagaatgagttagtaccaacctat
gaggaaagaataaagacaagtgcaccatcttactatgacaactaccctgctgagcagaaa
attgaatatgaaaagaaattgaccacaatcatagacccactattggaagagagaaaggta
tctgaggacaattag

DBGET integrated database retrieval system