KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0306Help
Entry
Saci_0306         CDS       T00251                                 

Definition
(RefSeq) acetyl-CoA synthetase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saci_0306
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saci_0306
   00620 Pyruvate metabolism
    Saci_0306
   00640 Propanoate metabolism
    Saci_0306
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saci_0306
   00680 Methane metabolism
    Saci_0306
Enzymes [BR:sai01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Saci_0306
Lipid biosynthesis proteins [BR:sai01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Saci_0306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(260644..262641)
Genome map
AA seq 665 aa AA seqDB search
MSVSWALPFEQKIIPKKGASKLVDINTYKEIHSQTVKEYRNFWASVASELEWFKPWEKVL
DDSNPPFYKWFVGGEINASYLAVDRHAKSWRKNKVAILWEGEPVDERGNPKEVRKLTYHD
LYKEVNRVAYLLKEKYKLKKGDTIAIYLPMIPELPIFMLAAARLGVVFTVVFSGFSADAL
ANRINDAEAKLVVTADGGWRRGKIVELKQIVDKALEKTPTVKDVIVVRRTGHKVNMMEGR
DKYFDEVIKDIPQNVYVEPERLKSEDPLYILYTSGTTGKPKGIVHDIGGYETLLHATMRW
VFDIRDDDIYWCTADIGWVTGHSYIVFGPLTEGATTVMYEGALDYPQPDRWVSIIERHSV
TILYTSPTAIRTFMKFGEEWVKKHDTSTVRLIHSVGEPINPEAQDWMWKLVGREEIPFGS
TWWMTETGGIMISHLPGLYLIPMKPGTNGMPIMGVEADVVNDDGKPSNLEDRGYLVIKNP
WPGMPLTIYKDPERYVKVYWSKFPGMFYAGDYAVKDRDGYFWILGRADEVIKVSGHRLGT
YELESALIEHPAVAEAAVVGVPDPVKGEVPYAFVVLRSGQTPSQQLTQEILKTVREKVGP
IAVVDKVFFVSKLPKTRSGKIMRRVVKAVVTKAEVGDITTLEDEASVDEVKKAYEEFKAE
VGKSS
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtatcctgggctcttccttttgaacaaaaaataatacccaaaaagggtgcaagt
aaactagtagatataaatacttacaaagagattcacagtcaaacagttaaggagtataga
aatttctgggcatcagtggcttctgaactggaatggtttaaaccatgggagaaggtccta
gatgactctaatcctccattctataagtggtttgtaggtggggagattaacgcctcatac
ctagctgtagatagacatgctaaaagttggagaaagaacaaggttgctattttatgggaa
ggagaaccagtggatgaaaggggaaatcctaaagaagtgaggaagctaacttatcacgat
ctttataaagaagttaatagggtagcctatctccttaaagagaaatacaagctgaagaag
ggtgacactattgccatttacctacccatgattcctgagctacctatattcatgctagca
gctgccagactgggtgttgtgtttacagtggtcttttcaggatttagcgctgatgcactt
gcaaacaggataaatgatgctgaggcaaagcttgttgtaacagccgatggagggtggaga
aggggcaagatagtagagttgaagcaaattgtcgataaagctctagaaaagacacctaca
gtaaaagatgttatagtggttaggagaacaggacacaaggtaaacatgatggaaggaaga
gataagtattttgatgaagtgataaaggatataccgcagaatgtttatgtagagcctgaa
aggctaaagtcagaagatccgttatacatactttacacctcaggtactacaggaaagcct
aaggggatagtccatgatattggaggctacgagactctgcttcacgctaccatgaggtgg
gtgtttgatataagggatgacgatatttactggtgtaccgcagatattggatgggtcact
ggtcactcttacatagtatttggtcctctaacagagggtgcaacaaccgtaatgtacgaa
ggagcgctagactatccacaacctgataggtgggtctcgataattgaacgccacagtgta
acaatactatacacttccccaactgcaattaggactttcatgaaatttggagaagaatgg
gtaaagaagcacgatacaagtactgtaaggctgattcactctgttggagaaccaataaat
ccagaggcgcaggattggatgtggaaattagttggaagagaggaaataccattcggttct
acatggtggatgacagaaaccggaggaataatgataagccacttgccgggtctctatcta
attccaatgaaacctggaactaatggaatgccaataatgggtgttgaagctgatgtagta
aatgacgatgggaaaccctctaatttagaggacaggggatatctagtcataaagaacccg
tggccaggaatgccattaacaatatacaaggatcctgagagatacgttaaagtgtactgg
agcaaattcccaggtatgttttatgcaggcgattatgcagtgaaggatagggatgggtac
ttctggatactaggcagagcagatgaagtcataaaagtgtctggtcacagattaggtacc
tatgagttagagtcagcgttaattgaacaccctgcagtagcagaggctgcagtagtcggc
gtacctgatcctgtaaagggagaagtaccctatgcgttcgtggtgctcagatctggacaa
actcccagccaacagttaacccaggagattttgaagactgtaagagaaaaagttggtccg
attgctgtggtagacaaagtgttctttgttagtaaattaccaaagaccagaagtgggaaa
ataatgagaagagtagtaaaagcagtagtaactaaggcagaagtaggagatataacaacg
ttagaggacgaagcgtcagttgacgaagttaagaaggcttatgaagagtttaaagctgaa
gtaggaaaatcaagttaa

DBGET integrated database retrieval system