KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0553Help
Entry
Saci_0553         CDS       T00251                                 

Definition
carbohydrate kinase (EC:2.7.-.-)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Saci_0553
Enzymes [BR:sai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Saci_0553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
450973..451836
Genome map
AA seq 287 aa AA seqDB search
MKPLHLSVGRINIDIIAKINKIPDIDEFETTDTLEILPGGAAVNYAVAINKFGHSIKILS
KIGKDSLVSYVLERIAEMGVGLDYVEETNLPQSMALIFLRDNGSISMVRKLGSSILLDKE
DIKKVFGLFDVIHFASISPDIVVRDPYAKLITYDPGPNSSKIPENFGNADIIYLNEREST
KVKIESLKARLIVIKMGSKGAKVISENEECYCEPYKVQTVLDTTGAGDVFDAAFNYAYVQ
GYSIEDTLRFAVTASALKVMRIGGINSPTREEVMNALNAYTPNTKCK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacttcacttgtcagtaggcaggataaacattgatattatagctaagattaac
aaaatacctgatatcgatgagtttgaaacaacagatacactagaaattttaccaggtgga
gcagcagttaattatgctgtagctataaacaaatttggtcacagtattaagattttatct
aagataggcaaagattcacttgtgtcttatgtactagaaaggatagcagaaatgggagta
ggacttgattacgtagaggaaacaaacttaccacagagcatggcattaatatttttgaga
gataacggaagcatttcaatggtcaggaagctaggctcttcaattctccttgataaagag
gatataaagaaagtcttcgggctatttgatgttatacattttgcttcaatttctccggat
attgttgttagggatccttacgctaaacttataacttatgatccaggtccaaatagttca
aaaattcctgaaaattttgggaatgcagatataatatatttgaatgagagggaaagcact
aaggttaagatagaaagtcttaaagcacgattgatcgtaataaaaatgggatcgaaggga
gctaaagtaatatcagaaaatgaagagtgctattgcgagccatataaagttcaaactgtt
ttagatacaacaggtgctggagatgtttttgacgccgcatttaattatgcgtatgtgcag
ggatactcaatagaggatactcttagattcgctgtaactgcctctgcactaaaagtaatg
agaataggagggataaattctcccactagagaggaagttatgaatgccttaaatgcttat
acaccaaatactaaatgtaaatga

DBGET integrated database retrieval system