KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0671Help
Entry
Saci_0671         CDS       T00251                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saci_0671
   01230 Biosynthesis of amino acids
    Saci_0671
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saci_0671
   00030 Pentose phosphate pathway
    Saci_0671
   00051 Fructose and mannose metabolism
    Saci_0671
  Energy metabolism
   00680 Methane metabolism
    Saci_0671
Enzymes [BR:sai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Saci_0671
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Saci_0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(531780..532937)
Genome map
AA seq 385 aa AA seqDB search
MKTTISVIKADIGSLAGHHVVHPDTMAAASKVLAEAKSQSLLIDYYITHVGDDLELIMTH
TRGELDTKVHETAWNAFKEAAKVAKELGLYAAGQDLLSDSFSGNVRGLGPGVAEIEVEER
PSEPIAIFMADKTEPGAFNLPLYKMFADPFNTPGLVIDPTMHNGFKFEVLDVYQGEAVVL
NAPQELYDLLALIGTPSRYVIRRIYRSEDNLLGAVVSIERLNLIAGKYVGKDDPVTIVRL
QHGLPALGEALEAFTLPHLVPGWMRGSHYGPLIPVSQRDARATRFDGPPRLIGLGFNVKN
GKLVGPSDLFDDPAFDEVRRLANTITDYMRRHGPFMPHRLEPTEMEYTTLPIILEKLRSR
FKKESDVYKVKESIYSKEKSGPSGD
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaacaattagtgtaataaaagcagatataggtagtttagccggacatcatgtt
gtacatccagatactatggcagcagcaagtaaagttctagctgaagctaagagtcaaagt
ctacttatagattattatataactcacgtgggtgatgacctagagctcataatgactcat
actagaggagaactggatactaaggttcatgaaactgcttggaacgcttttaaagaagca
gcaaaggttgcaaaggagttaggtttatacgcagctggtcaggatcttttatcagactcc
ttctcaggaaatgttagagggctaggaccaggcgtagctgagatagaagtagaggaaaga
ccgtcagagcctatagctatatttatggcagataagacagaacctggagcctttaactta
cctctatataaaatgtttgcagacccatttaacacgccaggtcttgtaatagatccgact
atgcataacggattcaaatttgaagttctagatgtatatcagggagaagcagttgtgtta
aacgctcctcaagagctttatgatctactagccttaatcggaactccgtcaagatatgta
attagaagaatatatagaagtgaggataaccttttaggagctgtagtatctatagaaaga
ttaaatttgattgcaggaaagtatgtaggaaaagacgatccggtaaccatagttagattg
caacatggtttgcctgcattaggtgaagctctagaggcatttacactacctcaccttgtt
cctggttggatgagaggtagtcactatggtcctcttattccagtatctcagagagatgct
agggctaccagatttgatggtcctccaaggcttatagggttaggttttaacgttaaaaat
ggaaagttggtaggtccatcagatttatttgatgatcctgcttttgatgaagttagaaga
ttagcaaataccataacagattacatgagaaggcatggtccatttatgcctcatagattg
gagcctactgaaatggaatatacaactctgccaattatacttgaaaaattgaggtctagg
tttaaaaaagagagcgatgtgtataaggtaaaagaaagtatatattcaaaagaaaaaagc
ggaccatcaggagattaa

DBGET integrated database retrieval system