KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0778Help
Entry
Saci_0778         CDS       T00251                                 

Gene name
alaD
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Saci_0778 (alaD)
Enzymes [BR:sai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Saci_0778 (alaD)
Exosome [BR:sai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Saci_0778 (alaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
620910..621920
Genome map
AA seq 336 aa AA seqDB search
MVNFPTLRPRRLRSNKLLRDFVAQTHLNAANLILPIFVKDGISEPEQIQSMPDVYRYPPN
DKLIKYVENVKEKGIKNIILFGIPAYKDEVASSAYAKDGVIQRALKMLRESFKDQILLIA
DECTDEYISHGHCGIVLRRNGNLVIDNDESLRIHSKIAVSQAEAGADVIAPSSMMDGVVG
AIRRDLDEAGYKDVAIMAYSAKYASTFYSPFRDAAYSKPSFGDRRGYQMDPRNSYEAIKE
VKLDIEEGADIVMVKPAHTYLDVIRIVKDEFPEYPLAAYHVSGEYSMIKAAAINGWIDEK
TAVLEITTAIKRAGADLIITYYAEKIAEWIREGVPF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggtcaattttccgacactaagacccagaagattgagaagcaataagttgttgagagat
tttgttgcacaaactcacttaaacgcagctaatcttatattaccaatttttgtaaaggat
ggaataagtgagcctgagcaaatacagagtatgcctgatgtttataggtatcctccaaac
gataaactaataaaatacgttgaaaacgtgaaggaaaaaggaataaaaaatataatttta
tttgggattcctgcctataaggacgaagtagcttcttccgcatacgcaaaagacggtgta
attcaaagagctttgaagatgcttagagaatcctttaaagaccaaattctacttatagct
gatgaatgtacagatgaatacataagccatggacattgtggtatagtactaagaagaaac
ggtaacttagttattgataatgatgaaagtttgcgtattcactctaagatagctgtaagt
caagctgaagcaggtgcagacgttatagcaccatcgtcaatgatggatggagtagtaggt
gcaataagacgagatctggacgaggctggttataaagatgtagctataatggcgtatagt
gcaaaatacgcatcgactttttattcaccttttagagatgctgcatattctaagccctct
tttggagatagaagaggatatcagatggacccaagaaattcctatgaagctataaaggaa
gtgaaattggacatagaggaaggtgcagatatcgtaatggtgaaacctgctcatacatac
ttagatgtaataaggatagttaaagatgaatttcctgagtatccattggctgcctatcac
gttagtggagaatatagtatgataaaagccgctgccataaatggttggatagatgagaag
actgccgttctagagataactacagcaataaagagagcaggagctgatctaataataacc
tattatgccgaaaaaatagctgagtggataagagaaggtgttccattttga

DBGET integrated database retrieval system