KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0781Help
Entry
Saci_0781         CDS       T00251                                 

Definition
(GenBank) conserved protein
  KO
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Saci_0781
Enzymes [BR:sai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Saci_0781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
624134..624703
Genome map
AA seq 189 aa AA seqDB search
MKYDNEILNQIDGIGFTSVNGVMCFKDFDRIRLSKIYAVGRSTAMAIMNKGFPDVKVPTE
FTVNSMIQLMLNDGLKNPVVVRSKVGYERDRELIRNVVFLVDYDLEVIEHNLERAKSLIK
ECRVDIVVVTSSKIASLIKDSISNCIKIVSIGPITSSALEGVNNIYEAKQHDINGVLNII
SDLLRDSNG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatatgataatgagattcttaatcaaattgacggaattggatttactagtgtaaat
ggcgttatgtgttttaaggattttgatcgtattcgcctcagtaaaatttacgctgtaggt
agatcaactgcaatggcaataatgaataaggggtttcctgatgtaaaggttcccacagaa
tttacagtgaatagtatgattcagttaatgttaaatgatgggttaaaaaaccctgtagtt
gtgagaagtaaggtaggatatgaaagagatcgagaattgataaggaatgttgtttttctt
gtcgactatgaccttgaagttattgagcataatctcgaacgtgcaaaatcactcattaaa
gaatgtagagtagatattgtggtagttactagttccaagatagcaagtttaataaaagat
tctatatctaattgcatcaaaatagtaagtataggaccaattacttcatctgctttagaa
ggagtaaataatatatatgaagcaaagcaacatgatataaacggagttttaaatataata
tctgacttgttgagggatagtaatggatga

DBGET integrated database retrieval system