KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0781Help
Entry
Saci_0781         CDS       T00251                                 

Definition
(GenBank) conserved protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
sai00860  Porphyrin and chlorophyll metabolism
sai01100  Metabolic pathways
sai01110  Biosynthesis of secondary metabolites
sai01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Saci_0781
Enzymes [BR:sai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Saci_0781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 DNA_pol_lambd_f
Motif
Other DBs
NCBI-ProteinID: AAY80154
UniProt: Q4JAM5
Position
624134..624703
Genome map
AA seq 189 aa AA seqDB search
MKYDNEILNQIDGIGFTSVNGVMCFKDFDRIRLSKIYAVGRSTAMAIMNKGFPDVKVPTE
FTVNSMIQLMLNDGLKNPVVVRSKVGYERDRELIRNVVFLVDYDLEVIEHNLERAKSLIK
ECRVDIVVVTSSKIASLIKDSISNCIKIVSIGPITSSALEGVNNIYEAKQHDINGVLNII
SDLLRDSNG
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatatgataatgagattcttaatcaaattgacggaattggatttactagtgtaaat
ggcgttatgtgttttaaggattttgatcgtattcgcctcagtaaaatttacgctgtaggt
agatcaactgcaatggcaataatgaataaggggtttcctgatgtaaaggttcccacagaa
tttacagtgaatagtatgattcagttaatgttaaatgatgggttaaaaaaccctgtagtt
gtgagaagtaaggtaggatatgaaagagatcgagaattgataaggaatgttgtttttctt
gtcgactatgaccttgaagttattgagcataatctcgaacgtgcaaaatcactcattaaa
gaatgtagagtagatattgtggtagttactagttccaagatagcaagtttaataaaagat
tctatatctaattgcatcaaaatagtaagtataggaccaattacttcatctgctttagaa
ggagtaaataatatatatgaagcaaagcaacatgatataaacggagttttaaatataata
tctgacttgttgagggatagtaatggatga

DBGET integrated database retrieval system