KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0806Help
Entry
Saci_0806         CDS       T00251                                 

Definition
phosphoglucomutase/phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saci_0806
   00030 Pentose phosphate pathway
    Saci_0806
   00051 Fructose and mannose metabolism
    Saci_0806
   00052 Galactose metabolism
    Saci_0806
   00500 Starch and sucrose metabolism
    Saci_0806
   00520 Amino sugar and nucleotide sugar metabolism
    Saci_0806
  Nucleotide metabolism
   00230 Purine metabolism
    Saci_0806
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Saci_0806
Enzymes [BR:sai01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Saci_0806
    5.4.2.8  phosphomannomutase
     Saci_0806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(645632..646996)
Genome map
AA seq 454 aa AA seqDB search
MGKLFGTDGVRGLINKDLSPELVLKLSRAIGSFFGKGSKLLVGRDVRAGGDMYVKLVEAG
LLSTGVDVFYGGLAPTPTLQYAVKTLGYDAGVIVTASHNPPEYNGIKVIDKDGVEIRREK
ENEIEEILFSERFNSIEWKALTNDVKKEDRVIPTYVKGILQHVDTEKISKKGYTVLIDSA
NSVGGLTSPLVAKELGCKVYTLNGNLDPLFPARMPEPTFESLKETAKIALTLKADLSIAH
DGDADRAIFLDSEGRVQWGDRSGTLLSYWSHVKNPKGSRVIVTAVSSSSLTEEYLAKYGL
EVLWTKVGSVDIAHKLQDEKGLAGFEENGGFIYPPHQYVRDGAMSFALMLEFMASENLSS
AQLFDRLPKYYLVKTKVNLKPQYDIQGLYGDLIKSYGNRGKVITIDGVKIIGEDFWFLVR
KSGTEPIIRIIVEAKDESKAMLLAEELKKFVESK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaattattcggcactgatggagttagaggcttgataaataaggatctgtctcca
gagcttgtccttaaactttcccgagccataggctcgttctttggtaagggcagtaaactg
ctggtaggtagagatgttagagctggaggagatatgtatgttaaactggttgaagcggga
ctattaagcacaggagtagacgttttttatggcggactagcacctactcctactttacag
tatgctgtaaaaacgttaggatatgatgcgggtgtaattgttaccgcaagtcataatccg
ccagagtataatggaatcaaagtaatagataaggacggagttgaaataagaagagagaaa
gaaaatgaaatagaggaaattttgtttagtgagaggtttaatagcattgaatggaaagct
cttactaatgacgtaaaaaaagaagatagagtgatcccaacctatgtgaaggggatatta
cagcatgtagatactgagaagatatctaaaaaaggatatactgtattaattgattctgca
aatagtgtaggagggttaacaagtccattagtagcaaaagagttaggatgtaaagtatat
accctaaatggaaatttagatccgttatttccagcgagaatgcctgaacccacatttgaa
tctctaaaagaaaccgcaaaaattgcattaacactaaaagccgatctatccatagcccat
gatggagatgctgacagagcaatttttcttgactccgaaggcagagtccagtggggagac
agaagtgggaccttattatcatattggagtcatgtgaagaaccctaagggtagtagagta
attgttactgcggtatccagctctagtctcacagaggagtatttagcaaaatatggtctt
gaggttttatggacaaaagtaggtagtgttgacattgcacataagctacaggacgagaaa
ggattagcaggttttgaggaaaacggtggtttcatatatccaccacatcaatacgttaga
gatggtgcaatgagctttgccttaatgctagaatttatggcaagtgagaatttatcttca
gcccaactatttgatagattacctaaatattatctagttaaaactaaggtaaatttgaaa
ccacaatatgacatacaggggttatatggagatcttataaagtcctatggtaatagggga
aaagtgattactattgatggtgttaaaataataggagaagacttttggttcctggtcaga
aagagtggtacagaacctatcattaggataatagtagaggctaaagacgaaagtaaagca
atgcttttagctgaagaattaaaaaaatttgtagaaagcaaatga

DBGET integrated database retrieval system