KEGG   Sulfolobus acidocaldarius DSM 639: Saci_0863Help
Entry
Saci_0863         CDS       T00251                                 

Definition
agmatinase (EC:3.5.3.-)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Saci_0863
Enzymes [BR:sai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Saci_0863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
691161..692051
Genome map
AA seq 296 aa AA seqDB search
MVDSRLLYLNESSRQFAGFNKTTSPFVIVGIPLDITSSFRPGSRFAPSVIREVAQYIEFY
SMRTGIDMGEIGFSDVGDIVMHPSNVEENIKRIKDVVSYFSEKGKIVVSIGGEHSITVGT
TEGTNADCVLSIDAHLDLRDEYMGYKYDHACVMRRISERGVKIIELGTRAVSKEELEYAN
QKGIMYLNPRQVNLLGIRGTAEKVKRGLAECKRIYLTYDMDGIDPAYAPGVATPEPEGLD
PTTVLEIVNMVTDKRIVGFDVVEISPPHDPSNITSVLASRFILETASIIFKSLSLS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggtcgattcaaggcttttgtacctcaacgagagttcaaggcagtttgcaggtttcaat
aaaactacatctccttttgtaatagtaggaataccactagatattacaagcagttttaga
ccaggctccagattcgctccctcagtaatcagagaagttgcacaatatatagaattttat
tccatgagaactggaatagatatgggtgaaataggatttagtgatgtaggagacattgtt
atgcatccatcaaatgtagaagaaaatataaaacgcataaaagacgtagtttcttacttc
tccgagaaggggaaaattgttgtaagtataggtggagagcatagtataacagtgggtaca
actgaaggaacaaatgcagattgtgtattgagcattgatgctcatctagatcttagggac
gaatatatgggttataagtacgatcatgcttgtgtaatgagaaggatttctgaaagggga
gtaaagattattgagctaggtaccagagcagtatctaaggaggaactcgaatatgcaaac
caaaagggtataatgtatctaaatcctcggcaagtcaatttattaggaattagaggcact
gctgaaaaggtaaaaaggggattagcggaatgtaagaggatatacttaacttatgatatg
gacggaatagatcctgcatacgctccaggagtggcaactccagagcccgaaggattagat
cctactacagttctagaaatagttaatatggttacggataaaagaattgttgggtttgat
gtggtggaaatatcgccacctcacgacccatccaacataactagtgtcttagcatctaga
tttatacttgaaacagcatctataatatttaaatcgctttcactatcttaa

DBGET integrated database retrieval system