KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1023Help
Entry
Saci_1023         CDS       T00251                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Saci_1023
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Saci_1023
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Saci_1023
Enzymes [BR:sai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Saci_1023
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(823076..824113)
Genome map
AA seq 345 aa AA seqDB search
MVRNLVINMVNIKCSRCGKERESLHEIKCKKCGGVFEVEIDFEFRKENLKDNFPYIREWV
TLGEGNTPLIRRGKVWFKLDFLNPTGSYKDRGSVTLISYLASNGIKDIAEDSSGNAGASI
AAYGKAAGMNVTIFVPETARGNKVKQIEAYGAKLMKVSGTRDDVTKAAEKSGYYYASHVF
QPHFRDGIRSLAYEIVRDLNWKIPEKVFIPVSAGTLLMGVYSGFKHLMESGVIEKIPTIV
AVQTKQVMPVCAKLNNLSYAPPAKVTSIADALVSTNPALLQEMTDVLQNYGECRVVDDNQ
ITEAWKELTKIGLLVEYSSATVYASLRKDDENSVLVLTGNGLKVL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
ttggtaagaaatctagttattaacatggtaaatattaaatgctcaaggtgtggaaaggaa
agagaaagtttacatgaaataaaatgtaaaaaatgcggtggagtatttgaggtagagatt
gattttgagttcagaaaggaaaatctcaaggataacttcccctacataagggaatgggta
actttaggagaaggcaatactccacttattagaaggggaaaagtctggttcaaactagat
ttcttaaaccctacaggctcctataaggacagaggaagtgtcacgctaatctcttacttg
gcttctaatggaataaaggatatagcagaggactcctcaggaaatgcaggagcatcaatt
gcagcttacggaaaggctgcaggcatgaatgtaactatttttgtccctgagacagccagg
ggaaataaggttaaacagatagaagcttatggagcaaaattgatgaaagtgagcggaaca
agagatgacgtaactaaggcagcagaaaaatcaggatattattatgcctcccacgtattt
cagccccatttcagagatggaatcaggagtctagcttatgaaatagtcagggatttaaat
tggaaaattcctgagaaagtattcataccggtctctgctggtacactcttaatgggagtc
tactctggtttcaaacatctcatggaaagtggtgtcatagaaaagattcctaccatagta
gctgtccagaccaaacaagtcatgccagtttgcgctaaacttaacaatttaagctatgca
ccaccagccaaagtgacttcaatagcagacgcgttagtctccactaatccagcactatta
caggaaatgacagatgtgttacagaattatggtgagtgcagagtagtagatgataaccaa
ataacggaagcgtggaaggagcttactaagataggcttacttgttgaatatagttccgct
acagtttatgcgtccttaagaaaagatgacgaaaattctgtcttagtactcacaggaaac
gggttaaaggttttataa

DBGET integrated database retrieval system