KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1044Help
Entry
Saci_1044         CDS       T00251                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(844047..845417)
Genome map
AA seq 456 aa AA seqDB search
MISGVTIVSVMTHPHRCPHGKCIFCPGGVEYGTPQSYYGNEPTLMRAIENNYEPFYQVQS
RLRQYEANGHNPSKIELIIMGGTFLATPLDYQDWFVTQALEAMNRYPSNQKPGFILLEDA
QLRNETASIRCVGLTVETKPDWSKEVHAKQMLRLGVTKVELGVQTVFDDLLTKSNRGHTV
KDSIEATKILKDNGFKVVYHMMLGLPGSDPDKDLESFERIFSDPDFSPDMLKIYPTLVVE
TAPLAELWKKGLYKPYDTETLVELISEIYKLIPPWVRVMRVQRDIPATIIIDGNKKGNLR
ELVENRAKQKGIKINEIRHREVGIKWIHTGKLPTGEPKLKRYDYEASGGTEVFLSYEYDD
DTLVGYLRLRKPSNKDDVTIVRELHIYGPETPVGLWDDFSFQHKGYGGRLLSEAERISVE
EFDAKKILVLSGIGVREYYRKKGYHNEYPYVAKDLK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgatctcaggagttacaatagtgtcagtaatgacacaccctcacagatgccctcatgga
aaatgtatattctgcccaggaggtgttgagtatggtacaccgcagagctattacggaaat
gaacctacactaatgagggctatagaaaataattatgaaccattctaccaagtccaatct
cgcctcagacagtatgaggctaatggtcataatccgagtaagatcgagcttataatcatg
gggggaacatttctcgctactcccttagattatcaagattggtttgttactcaagcccta
gaagctatgaatagatatccctctaaccagaaacctggtttcatactcttagaggacgca
caactgagaaacgagactgcgtcaattagatgtgttggattaaccgtagaaacaaaaccg
gactggagtaaagaagttcatgctaagcaaatgcttagacttggagtgacaaaagttgaa
ctgggagttcaaacagtgtttgatgatctgttgacgaaaagtaacaggggtcatacggtt
aaagactcaatagaagctactaaaattctaaaagataatggatttaaagtagtatatcac
atgatgcttggcttgcccggcagcgaccctgataaggatctggagtcatttgagagaata
ttttctgatcctgatttttcaccagatatgttgaaaatatatccaacactagtagtagaa
acagcaccattagctgaactgtggaaaaagggtctttacaaaccatatgatactgaaaca
ctagttgaacttatttcagaaatctacaaactgataccaccttgggtgagagtaatgaga
gttcaaagagatatacctgcgacaatcattattgatggtaacaagaaaggaaacctcaga
gaactagtcgagaacagggcaaaacagaagggcattaaaatcaacgaaattagacacaga
gaagtaggaataaagtggatacatacgggaaagttacctactggtgaaccaaaattaaag
agatatgattatgaagccagtggagggacagaggtgttcttatcttacgaatatgacgac
gatacactggtgggctatctcaggttaagaaagccaagtaataaagatgacgtcactata
gtgagggagttacatatctacggaccagaaactccagtaggactttgggatgatttttcc
ttccaacataagggatatggaggaagattattatcagaggctgaaagaatatcagtagag
gaatttgatgcgaaaaagattctagtgctttcagggattggtgttagagaatattacaga
aagaagggatatcacaatgaatatccttacgttgcaaaggatttaaaatga

DBGET integrated database retrieval system