KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1088Help
Entry
Saci_1088         CDS       T00251                                 

Definition
hypothetical protein
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saci_1088
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saci_1088
   00020 Citrate cycle (TCA cycle)
    Saci_1088
   00620 Pyruvate metabolism
    Saci_1088
   00640 Propanoate metabolism
    Saci_1088
   00650 Butanoate metabolism
    Saci_1088
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saci_1088
   00680 Methane metabolism
    Saci_1088
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Saci_1088
Enzymes [BR:sai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Saci_1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(889453..889776)
Genome map
AA seq 107 aa AA seqDB search
MNFDTCIKCKSCWIHCPDECLDERSIGYYGIAYDYHVNYGVHAKVYPVKDYIVIADEKMF
TDYRRPYEMWKENKAKYKDWLKSGRISKKRKGKHSMVGKMTRNSNSF
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
gtgaacttcgacacatgtattaaatgtaaatcgtgctggattcactgtcctgacgagtgt
cttgatgaaagatctattggttattatggcattgcttatgattaccatgtaaactatgga
gttcacgcaaaagtttatcctgtaaaggattatatagtcattgctgatgagaagatgttt
acagattacaggagaccatatgaaatgtggaaggaaaataaggcgaagtataaggattgg
ctaaaatcaggcaggataagcaagaaaagaaagggtaaacattccatggttggaaagatg
actcgaaattctaactcattttga

DBGET integrated database retrieval system