KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1088Help
Entry
Saci_1088         CDS       T00251                                 

Definition
hypothetical protein
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Dicarboxylate-hydroxybutyrate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sai01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sai00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sai00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sai00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sai00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sai00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:sai00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:sai00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:sai00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(889453..889776)
Genome map
AA seq 107 aa AA seqDB search
MNFDTCIKCKSCWIHCPDECLDERSIGYYGIAYDYHVNYGVHAKVYPVKDYIVIADEKMF
TDYRRPYEMWKENKAKYKDWLKSGRISKKRKGKHSMVGKMTRNSNSF
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
gtgaacttcgacacatgtattaaatgtaaatcgtgctggattcactgtcctgacgagtgt
cttgatgaaagatctattggttattatggcattgcttatgattaccatgtaaactatgga
gttcacgcaaaagtttatcctgtaaaggattatatagtcattgctgatgagaagatgttt
acagattacaggagaccatatgaaatgtggaaggaaaataaggcgaagtataaggattgg
ctaaaatcaggcaggataagcaagaaaagaaagggtaaacattccatggttggaaagatg
actcgaaattctaactcattttga

DBGET integrated database retrieval system