KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1088Help
Entry
Saci_1088         CDS       T00251                                 

Definition
(GenBank) conserved Archaeal protein
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
sai00010  Glycolysis / Gluconeogenesis
sai00020  Citrate cycle (TCA cycle)
sai00620  Pyruvate metabolism
sai00640  Propanoate metabolism
sai00650  Butanoate metabolism
sai00680  Methane metabolism
sai00720  Carbon fixation pathways in prokaryotes
sai01100  Metabolic pathways
sai01120  Microbial metabolism in diverse environments
sai01130  Biosynthesis of antibiotics
sai01200  Carbon metabolism
Module
sai_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saci_1088
   00020 Citrate cycle (TCA cycle)
    Saci_1088
   00620 Pyruvate metabolism
    Saci_1088
   00640 Propanoate metabolism
    Saci_1088
   00650 Butanoate metabolism
    Saci_1088
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saci_1088
   00680 Methane metabolism
    Saci_1088
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Saci_1088
Enzymes [BR:sai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Saci_1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_10 Fer4_13 Tox-REase-5
Motif
Other DBs
NCBI-ProteinID: AAY80443
UniProt: Q4J9T8
Position
complement(889453..889776)
Genome map
AA seq 107 aa AA seqDB search
MNFDTCIKCKSCWIHCPDECLDERSIGYYGIAYDYHVNYGVHAKVYPVKDYIVIADEKMF
TDYRRPYEMWKENKAKYKDWLKSGRISKKRKGKHSMVGKMTRNSNSF
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
gtgaacttcgacacatgtattaaatgtaaatcgtgctggattcactgtcctgacgagtgt
cttgatgaaagatctattggttattatggcattgcttatgattaccatgtaaactatgga
gttcacgcaaaagtttatcctgtaaaggattatatagtcattgctgatgagaagatgttt
acagattacaggagaccatatgaaatgtggaaggaaaataaggcgaagtataaggattgg
ctaaaatcaggcaggataagcaagaaaagaaagggtaaacattccatggttggaaagatg
actcgaaattctaactcattttga

DBGET integrated database retrieval system