KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1117Help
Entry
Saci_1117         CDS       T00251                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Saci_1117
Enzymes [BR:sai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Saci_1117
Exosome [BR:sai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Saci_1117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(920171..921667)
Genome map
AA seq 498 aa AA seqDB search
MSKYILAVDEGTTSARALVFDEDLNVISIAQTELTQYFPRPGYVEQNPEEIFEKQVSMIK
KAVEKAKIEISQVSAIGIANQRETTIMWDSRSGRPVYNAVVWQDRRTSDITDWLKSNYLN
LFKSKTGLIPDPYFSASKIKWILDNVPGVREKAERGEIKFGTVDTYLIWKLTNGKVHVTD
YSNASRTMLFNIKKLEWDRDILEILEIPEAILPEVRSSSEVYGYAEPVGNIPISGDAGDQ
QAALFGQLGFSKGDVKCTYGTGSFILMNSGEEIYDSKDLLTTIAWKIGKDVKYALEGSIF
TTGAAVQWVRDGLGLVSSSDEIESLASSVVDNGGVYFVPAFSGLGSPYWDPYARGLIIGI
SRGTSRGHIARAVLESIAYQVRDVIEVIKKDVGKEFVNVLKVDGGVSKNNLLMQFQADIL
GIRIVRPRVIETTSMGASMLAGLAVDYWSSLEELKSKWAVDREFIPSLQEDRRERLYKGW
KEAVRRTIGWAREVETME
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaaatacatattggcagtggatgaggggactacaagtgcaagggctctagttttc
gatgaagacctaaacgtcataagcatagcacagactgaactgacacagtatttcccaaga
ccaggttatgtggagcaaaatcctgaggaaatatttgaaaagcaggtaagtatgataaag
aaagctgtagagaaagccaagatcgagattagccaggtttctgctattggtatagcaaat
cagagagagaccaccataatgtgggacagtaggagtggaagaccagtttacaatgctgtg
gtgtggcaggataggaggacttcggatataacagactggttaaaatcaaactaccttaac
ctgtttaagagcaagaccggtttaatccctgacccttattttagcgcttcaaagattaag
tggattcttgataacgtcccaggtgtaagagaaaaagcagagaggggcgaaataaagttt
ggcacagtagacacatatctaatttggaaactcactaatggtaaagtccatgttacagac
tactctaacgcatctaggacaatgctgtttaatataaaaaagttggagtgggatagggac
attctagaaattctagaaattccagaggcaatactgcctgaagttaggtcctccagtgaa
gtgtatggatacgctgagcccgttggaaatataccgatcagcggagatgctggagatcaa
caggctgcattatttggtcaactgggattcagtaaaggagatgtgaaatgtacttatggt
actgggagtttcatattaatgaactctggagaggagatatatgattcaaaagacctactt
accaccattgcgtggaaaatcggtaaagacgtaaagtacgcactagaagggagcatattc
acaaccggtgcagcagttcagtgggttagggacggactaggtttagtaagtagttccgat
gaaatcgagagtcttgcgtcaagtgttgttgataacggaggagtttactttgtccctgca
ttttctggtttaggttctccctactgggatccatatgctaggggtctgatcataggaatt
tcaagagggacaagtaggggacatatagccagggctgtcttggaatcgatcgcatatcag
gttagggatgtgatagaggtaattaagaaagacgttggaaaagaatttgtaaatgtccta
aaggtagatggcggtgtgtcgaaaaataacttgttaatgcaatttcaggctgacatattg
ggaataaggattgttagacctagagtgatagagactacatcaatgggtgcatctatgctt
gcaggtttagcagtggactattggagttccctagaagagttaaagagtaaatgggcagta
gatagggagttcattccttcattacaggaggatagaagggagagattgtataaggggtgg
aaggaagctgtcaggagaactattggttgggcaagagaagtggagactatggaatag

DBGET integrated database retrieval system