KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1265Help
Entry
Saci_1265         CDS       T00251                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
sai00020  Citrate cycle (TCA cycle)
sai00640  Propanoate metabolism
sai00660  C5-Branched dibasic acid metabolism
sai00720  Carbon fixation pathways in prokaryotes
sai01100  Metabolic pathways
sai01110  Biosynthesis of secondary metabolites
sai01120  Microbial metabolism in diverse environments
sai01130  Biosynthesis of antibiotics
sai01200  Carbon metabolism
Module
sai_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sai_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Saci_1265 (sucC)
   00640 Propanoate metabolism
    Saci_1265 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Saci_1265 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saci_1265 (sucC)
Enzymes [BR:sai01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Saci_1265 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AAY80609
UniProt: Q4J9C1
Position
1076212..1077225
Genome map
AA seq 337 aa AA seqDB search
MKLYEYEGKELFKAVGIPIPKGVVTDSPIKWDGKAVVKAQLLEGARGKRGLVKVTDNVEQ
TIAEMKKLGIQKFLVEEFIPHTRELYISALIDRDTAEPIIAASTEGGIDIESNSNVKIFH
IPMERGIRSYDVYNIEKYLGVKGIEPILKGLYRLITEFDAELAEINPLAVTNDGKIIALD
SKVILEDNALFRHEDLIQKLGRKPAESNYVELDGDVGIIGNGAGLTMATMDMVKIMGGNP
ADFFDIGGGAGRERVKEAIINIASNKKVKKIVMNIYSGITRCDEVAMGIVEALKIVKIPI
YVRLVGTNEEEGRRILRENGIPVYEDARSCIGDALRS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactgtatgagtatgagggaaaggagctatttaaggctgtaggtattccaatacct
aaaggagttgtaacggattctcctataaagtgggatggtaaagctgtagtgaaggcgcaa
ctactggaaggagctagaggaaaaaggggtcttgttaaagttactgataacgtagaacag
actattgcagaaatgaaaaaattgggcattcaaaagtttctagtggaagaatttattccg
cacaccagagagctatatatatcagctcttattgatagggatacagctgagccgattatc
gctgcttctacagaaggaggaatcgatatagagagcaatagtaatgttaaaatatttcac
atacccatggagagaggcataaggagttacgacgtctataatatagaaaaatacttaggt
gtaaaaggaatagaacctatcttaaaaggactttacaggcttatcaccgaattcgacgct
gaacttgccgagattaatccattggcagtaacgaatgacggtaaaataatagcattggac
tcaaaggtcattcttgaggataacgcgctatttagacatgaagacttaatacagaaatta
ggaagaaaacccgcagaatcaaactatgtggagctagacggtgatgttggaataattggt
aatggggcaggattaactatggctacaatggacatggtcaaaattatgggtgggaatcct
gcagacttctttgacataggaggtggagcaggaagagagagagttaaggaagctattata
aatattgcgtctaacaagaaagtaaagaaaattgttatgaacatatactctggtataaca
agatgtgacgaagtagctatggggatagttgaagctttaaaaatcgtgaaaatccccatt
tacgttagattagttgggacaaatgaggaagaagggagaagaattttaagggagaatggg
atacccgtatatgaagatgcaagaagttgtataggtgatgctctacgctcataa

DBGET integrated database retrieval system