KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1413Help
Entry
Saci_1413         CDS       T00251                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Saci_1413
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Saci_1413
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Saci_1413
Enzymes [BR:sai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Saci_1413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1205197..1206375)
Genome map
AA seq 392 aa AA seqDB search
MKCLDCGYELSELRQDIITCPSCGGLLEIKIEFPSEFDLRRLKGRGVWRYKDVIAGEYNK
IVTLDEGNTPLIKSRKYDKTYFKFEGANPTGSFKDRGMTVAISSALSLNYKIVVAASTGN
TAASAAAYSSRAGLKSFIVLPKGKVALGKLAQSILYGTVIIEVDGSFDIAMNSVMKLYRD
HKIVYPLNSFNPWRLEGQKTIAYEIVEDIGVPDNVIVPVGNAGNIYAIWKGFNELLEGGL
IDKVPRMIGIQAEGAAPIAKALEKGLEQPEFVDSPDTIASAIRIGKPVNWKKAIKAMKSS
KGFAVYVSDNEIITAQQELARREGVGAEPASAAAYAGYLKLLSSKKIEESEKSVVILTGH
ALKDPDIMIKAEAKRILVNPEHIDQVILGDQI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtttagactgtggatatgagttaagtgaattaagacaagacataataacctgc
ccctcatgtggaggattattagagataaaaattgaattccctagtgagtttgaccttaga
agattaaagggaagaggagtatggaggtataaagatgttatagcaggggaatataataaa
attgtaaccttagatgagggcaatacacccttaataaaatctagaaaatacgataagaca
tatttcaagtttgaaggagcaaatcccacaggaagttttaaagatagaggaatgacagta
gcgattagctctgcattatctctaaattataaaatagttgttgcggcttctacaggaaat
actgcagcatcagcagctgcctattcaagtagagcgggtttaaagagtttcatagtttta
cctaaaggaaaagtagcattaggaaagttagcacagtctatattgtatggtactgtaata
atagaagttgatggaagcttcgatatagcaatgaatagtgttatgaaactttatagagat
cataaaatagtttacccactaaactcgtttaatccctggagattagaaggtcaaaaaact
atagcttatgagatagtggaagacataggagtccctgataatgtaatagtaccagtaggg
aatgctggaaatatctatgcgatatggaaaggatttaatgaactcctagaaggaggctta
atagataaagttcctagaatgataggaatacaagcagaaggtgcagctccaatagctaag
gcactagaaaaaggacttgagcaaccagaattcgtagactcccctgatacgatagcttca
gcaataagaataggtaaaccggttaattggaaaaaagccataaaagcaatgaagtcaagt
aaaggattcgcagtgtatgtatctgataacgagattataactgctcaacaagaattggct
agaagagagggagtaggggctgaacctgcatctgctgcagcatatgctggatatctgaag
ctcttgtcatcaaagaagatagaagaaagtgagaaaagcgttgtaattctaacaggacat
gccctaaaagatccggatataatgataaaagcagaggctaaacgtattctggtgaatcct
gaacatatagatcaagttattttaggtgatcaaatatga

DBGET integrated database retrieval system