KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1421Help
Entry
Saci_1421         CDS       T00251                                 

Gene name
trpB1
Definition
(GenBank) tryptophan synthase beta chain 1
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
sai00260  Glycine, serine and threonine metabolism
sai00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sai01100  Metabolic pathways
sai01110  Biosynthesis of secondary metabolites
sai01130  Biosynthesis of antibiotics
sai01230  Biosynthesis of amino acids
Module
sai_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Saci_1421 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Saci_1421 (trpB1)
Enzymes [BR:sai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Saci_1421 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AAY80751
UniProt: Q4J8Y0
Position
1213114..1214388
Genome map
AA seq 424 aa AA seqDB search
MVNSFDIIPKYWYNIIPDLPKPLPPPRDPQDAEFSRIDLLRKILPKEVLRQEFTIERFVK
IPDEVRDRYINIGRPTPLIRARRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAA
NEGVSHVTTETGAGQWGTAVALAASMYDLESTIFMVRVSYEHKPMRRTIMELYGAKVHAS
PTDLTEFGRKILKEDSRHPGSLGIAMSEAIEYALENNYRYLVGSVLDVVILHQSIIGMES
INQLEALGEEPDTIIGCVGGGSNFGGFTYPFIGTKRGKKYIAVGSSEVPKFSKGKYEYDF
PDSAGLLPLVKMITLGKDFIPPPIYSGGLRYHGVAPTLSLLVKEKVVEWREYTEEEIYNS
AKIFMKTQGIIPAPESAHAIKAAIDEALEAKKTNDKKVILVNVSGHGLLDLSNYESMKNR
VMKK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatagtttcgatataattccaaagtattggtataatataatacccgatctccca
aaaccattacctccaccaagagatccacaagacgcagagttctcaagaattgatcttcta
agaaaaatcctcccaaaggaggtattaagacaagagtttaccatagaaaggtttgtaaag
atccctgatgaggttagggatagatatataaacataggtagacctacaccactgattaga
gcaaggagattagaagagtatttgaaaactccagcaaggatttatttcaaatacgagggc
gcaacaccaactggttctcacaagataaatacagcaatacctcaagcatattttgctgca
aatgagggagtttctcatgttaccactgaaaccggcgctggacagtggggaacagcagta
gccttggctgcttcaatgtatgatttagagtctaccatattcatggtcagggtaagttat
gagcacaaacctatgagaagaactataatggaattatatggtgctaaggttcatgcaagc
cctactgatctaacagagtttggtagaaaaattctaaaagaggattcacgtcatcctggg
tctttaggcatagctatgagtgaggcaatagagtacgccctggaaaataattataggtat
ttagttggaagtgtattagatgtagtaatcctgcaccaatccattataggtatggagtct
attaatcaacttgaggcactaggagaagaaccagataccataatagggtgtgtcggagga
ggaagtaattttggtggatttacatatccgtttattggtaccaagaggggaaagaagtat
atagctgtaggttcctcagaagtacctaaattcagtaaaggtaaatatgaatatgatttc
ccagactccgctggattattgccactggtaaagatgataactttaggaaaggatttcatt
cctcctcctatatattcaggcggacttagatatcacggagttgccccaacccttagttta
ctggttaaggaaaaagtggttgaatggcgcgagtatacagaagaggagatatataattca
gctaaaatctttatgaagactcaaggtataattccagcacctgaatctgctcatgctatt
aaggctgcaattgatgaggcactggaggctaaaaaaaccaatgataagaaggtgatattg
gttaacgttagtggtcatggtttgttagatttgagcaactatgaatctatgaaaaataga
gtgatgaagaaatga

DBGET integrated database retrieval system