KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1421Help
Entry
Saci_1421         CDS       T00251                                 

Gene name
trpB1
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sai01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sai00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sai00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1213114..1214388
Genome map
AA seq 424 aa AA seqDB search
MVNSFDIIPKYWYNIIPDLPKPLPPPRDPQDAEFSRIDLLRKILPKEVLRQEFTIERFVK
IPDEVRDRYINIGRPTPLIRARRLEEYLKTPARIYFKYEGATPTGSHKINTAIPQAYFAA
NEGVSHVTTETGAGQWGTAVALAASMYDLESTIFMVRVSYEHKPMRRTIMELYGAKVHAS
PTDLTEFGRKILKEDSRHPGSLGIAMSEAIEYALENNYRYLVGSVLDVVILHQSIIGMES
INQLEALGEEPDTIIGCVGGGSNFGGFTYPFIGTKRGKKYIAVGSSEVPKFSKGKYEYDF
PDSAGLLPLVKMITLGKDFIPPPIYSGGLRYHGVAPTLSLLVKEKVVEWREYTEEEIYNS
AKIFMKTQGIIPAPESAHAIKAAIDEALEAKKTNDKKVILVNVSGHGLLDLSNYESMKNR
VMKK
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatagtttcgatataattccaaagtattggtataatataatacccgatctccca
aaaccattacctccaccaagagatccacaagacgcagagttctcaagaattgatcttcta
agaaaaatcctcccaaaggaggtattaagacaagagtttaccatagaaaggtttgtaaag
atccctgatgaggttagggatagatatataaacataggtagacctacaccactgattaga
gcaaggagattagaagagtatttgaaaactccagcaaggatttatttcaaatacgagggc
gcaacaccaactggttctcacaagataaatacagcaatacctcaagcatattttgctgca
aatgagggagtttctcatgttaccactgaaaccggcgctggacagtggggaacagcagta
gccttggctgcttcaatgtatgatttagagtctaccatattcatggtcagggtaagttat
gagcacaaacctatgagaagaactataatggaattatatggtgctaaggttcatgcaagc
cctactgatctaacagagtttggtagaaaaattctaaaagaggattcacgtcatcctggg
tctttaggcatagctatgagtgaggcaatagagtacgccctggaaaataattataggtat
ttagttggaagtgtattagatgtagtaatcctgcaccaatccattataggtatggagtct
attaatcaacttgaggcactaggagaagaaccagataccataatagggtgtgtcggagga
ggaagtaattttggtggatttacatatccgtttattggtaccaagaggggaaagaagtat
atagctgtaggttcctcagaagtacctaaattcagtaaaggtaaatatgaatatgatttc
ccagactccgctggattattgccactggtaaagatgataactttaggaaaggatttcatt
cctcctcctatatattcaggcggacttagatatcacggagttgccccaacccttagttta
ctggttaaggaaaaagtggttgaatggcgcgagtatacagaagaggagatatataattca
gctaaaatctttatgaagactcaaggtataattccagcacctgaatctgctcatgctatt
aaggctgcaattgatgaggcactggaggctaaaaaaaccaatgataagaaggtgatattg
gttaacgttagtggtcatggtttgttagatttgagcaactatgaatctatgaaaaataga
gtgatgaagaaatga

DBGET integrated database retrieval system