KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1422Help
Entry
Saci_1422         CDS       T00251                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Saci_1422 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Saci_1422 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Saci_1422 (trpA)
Enzymes [BR:sai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Saci_1422 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1214385..1215122
Genome map
AA seq 245 aa AA seqDB search
MSKKYLVAYMTLGYPNVNDFYKFIDNIEDFGVDILEIGIPPKYAKYDGPVIRKTYKIVSN
NIKNYYEILYEVKQRIKIPVVILTYLEEYVDKLGDFLLKLKESRVDGVLFPDLLIDYVDE
YEKYVNLIKNEGIKTVLFTAPLMPDDLIIKASKLTDLFLYYGVRPTTGVVIPISIDSLIN
RIRTMVQSKLVVGFGLNSIEDIKKAMSVGADGIAVGTSLIEEVDKNGVNGALELIKKLRG
VLDEY
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaagtatctggtagcctatatgacgttaggctatcctaatgtaaatgatttc
tacaaattcatcgataacatagaggattttggggtagatattttagaaattgggattcca
ccaaagtatgctaaatatgacggacctgtaataaggaagacatataaaatcgttagtaat
aatataaagaactactacgagatactttatgaggtcaaacagagaatcaaaattccagtt
gttattttaacatatctggaagagtacgtagataagttaggagattttttactaaaatta
aaagaaagtagggtagatggtgttttattcccagatttgcttatagattatgttgacgaa
tatgaaaaatatgtcaatttaataaagaatgaaggtataaaaactgttttatttacagct
cccttaatgccggatgacctgatcattaaagcatctaaactaaccgatctatttctttat
tacggagtaagaccaactacaggtgtagttattccaataagtattgattctctgataaac
agaataagaactatggttcaaagtaagttagttgtaggctttggtttgaacagtattgaa
gatattaagaaagcgatgtcagtaggagcagacggaatagccgttgggacatctttaata
gaagaagttgacaaaaacggagtgaatggagcacttgaacttataaaaaaattgagagga
gtgctggatgaatattag

DBGET integrated database retrieval system