KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1579Help
Entry
Saci_1579         CDS       T00251                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
sai00340  Histidine metabolism
sai01100  Metabolic pathways
sai01110  Biosynthesis of secondary metabolites
sai01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Saci_1579
Enzymes [BR:sai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Saci_1579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AAY80892
UniProt: Q4J8I8
Position
1349259..1350440
Genome map
AA seq 393 aa AA seqDB search
MIKYEIPKSRPNEFSKVLPLVEQILNQVKERGDKALLELEEKYDKAKLDSLVENRIDELA
SKIPEEYKAAIDRIYDQLVEFHKTTLPYMVGGGYNGIEFGILWRAIEKVGIYVPGGLKSY
PSTLLMAAIPARVAGVSEIYVATPPNRIDSVIAYIAKKLKINALYRIGGAQAIAALAYGT
ESVKKVDKIVGPGNIFVQASKFLVSKDVAIDGIEGPTELVVIADSSADYRHVILDMRAQA
EHGSTSYIILVTTSDFLIDKVREELDKEEFTYYIVKVKSIDEAIDVANDIAPEHLSLFVN
DPKSYLHKIKNAGAISLGKTPPALIDYAAGPDHILPTNAWSRVRGGLTVYDFLKPISYAN
SVNPDKELVNMAKLIAEYEGFIYHSKSIGARYE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaaatatgagataccaaaatctagaccaaacgaatttagtaaagtactcccttta
gtcgaacaaatattaaatcaagttaaggaaagaggagataaagcactattagagttagag
gagaagtacgataaggctaaattagattccttagtcgagaatagaatagatgaactagca
agtaaaataccggaggaatataaggctgccatagacagaatctatgatcagcttgttgaa
tttcataagacaactctaccatatatggtagggggaggatataacggaatagaatttggt
atactttggagagcaattgagaaagttggtatatatgtacctggaggattgaagtcttat
ccctctacgttgttgatggctgcaattcctgctagagtagcaggagttagtgaaatttat
gtggcaaccccgccaaatagaatagactctgtaattgcatatatagctaaaaaactaaaa
attaatgcgttatatagaattggtggagctcaggcaatagctgcactagcttatggaact
gagagtgtgaaaaaggtagataaaattgtaggtccgggaaatatttttgtccaagcatcg
aagtttttggttagcaaagatgtggcaattgatggaatagagggaccaactgaactagtt
gttatagcagatagttcagcagattataggcatgttatattggatatgagagcacaagcg
gaacatggatctacatcttatataatactagttaccacttcagatttcctaattgataaa
gtaagagaggaattagataaggaggagtttacgtattatattgtcaaggtcaagagtata
gatgaagcgatagatgtggcaaacgatatagcgccagaacatttgtcgttgtttgtaaat
gatcctaaatcttatttacataagattaagaatgctggtgcaataagtctaggtaaaaca
cctccagcactgatagactatgcagctggtcctgatcacatacttccgacaaatgcttgg
tccagggtaagaggaggtttaactgtttatgacttcttgaagcccatttcctacgccaat
tccgtaaatcctgataaggaacttgtaaatatggcaaagttgatagctgagtacgagggt
ttcatatatcactctaagagcataggtgctaggtatgagtga

DBGET integrated database retrieval system