KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1645Help
Entry
Saci_1645         CDS       T00251                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.-)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sai01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sai00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1401092..1402240
Genome map
AA seq 382 aa AA seqDB search
MDDLLKLVSGLVKIPSVNPPHGEGLRDCANFIREYFSNHGYSAEVVEFDKGWPNIIVNNG
KKSDKSIMLNGHYDVVPTGDLKSWSHDPFSALILEDKIYGRGSSDMKSGLAVQMKVFVEL
ADKLDYNLVFTAVPDEESGGFHGAKHLAEKYKPNLVLVSEPSGSEWINIGEKGLLQVKLK
SKGKVAHGSLPSLGDNAIMKIVRDLVNLEKIRDVKIPIPSELKEAISARASSEVEKDYVS
ISFNPGVIKGGVKVNVVPDYAEAEVDMRIPPGIKNSEALSLVKKLVSESEVEPIDLSEPN
YTNPENHYVKKLEETISKTLGIRPKNYIITGATDGRYFRNKGIPAIVYGPGELGVAHTYN
EFVSFKEVINAYKVIREYLLSI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggacgacctattaaaactggtttctggactagtcaaaattcctagtgtaaacccacct
catggagaaggtttaagagactgtgcgaattttataagagagtatttctctaaccacggt
tatagtgctgaagtagtagaatttgataagggatggccaaacattattgttaacaatggt
aagaagagcgataagtctataatgctgaatgggcattatgatgttgttcctacgggagat
ttaaaaagctggtctcatgatcccttctcagctctaatacttgaagacaagatttacgga
agaggctcttctgatatgaagagcggtttagcagtccaaatgaaagtcttcgttgagtta
gcggacaagttagattataacctggtgtttactgcagtccctgatgaggaaagtggtggt
tttcatggcgctaaacatcttgcagagaaatacaagcctaatttagtattagtttcagag
ccctcaggatctgaatggataaatataggtgaaaaaggacttcttcaggttaagttaaag
tctaagggtaaggttgctcacggtagccttccttctcttggtgataacgctattatgaaa
attgttagggatctagtgaatttggagaagataagggatgtgaaaatacctatacctagt
gaactaaaggaagcaatttcagctagagcttcatctgaagtggagaaggattacgtatct
atatctttcaatcctggggtaattaagggtggcgttaaggtaaatgtagtccctgattac
gctgaggctgaagtagatatgaggataccacctggtataaaaaattcagaggctttatca
ttagttaagaagttagtaagtgagagtgaagtagaaccaattgacctctccgagcccaac
tatactaaccctgaaaatcattatgttaaaaagcttgaagaaacgataagtaagacctta
gggataagacctaagaattatatcataactggcgctacagacggacgctattttaggaac
aaaggaattcccgcaatagtttacggacccggagagttaggtgtcgcacatacttacaac
gagtttgtgagtttcaaggaggtaataaacgcgtataaggtcataagggaatatttactt
tcaatttaa

DBGET integrated database retrieval system