KEGG   Sulfolobus acidocaldarius DSM 639: Saci_1849Help
Entry
Saci_1849         CDS       T00251                                 

Gene name
bgaS
Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sai00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sai00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1618954..1620429
Genome map
AA seq 491 aa AA seqDB search
MLSFPKGFKFGWSQSGFQSEMGTPGSEDPNSDWHVWVHDRENIVSQVVSGDLPENGPGYW
GNYKRFHDEAEKIGLNAVRINVEWSRIFPRPLPKPEMQTGTDKENSPVISVDLNESKLRE
MDNYANHEALSHYRQILEDLRNRGFHIVLNMYHWTLPIWLHDPIRVRRGDFTGPTGWLNS
RTVYEFARFSAYVAWKLDDLASEYATMNEPNVVWGAGYAFPRAGFPPNYLSFRLSEIAKW
NIIQAHARAYDAIKSVSKKSVGIIYANTSYYPLRPQDNEAVEIAERLNRWSFFDSIIKGE
ITSEGQNVREDLRNRLDWIGVNYYTRTVVTKAESGYLTLPGYGDRCERNSLSLANLPTSD
FGWEFFPEGLYDVLLKYWNRYGLPLYVMENGIADDADYQRPYYLVSHIYQVHRALNEGVD
VRGYLHWSLADNYEWSSGFSMRFGLLKVDYLTKRLYWRPSALVYREITRSNGIPEELEHL
NRVPPIKPLRH
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgttatcattcccaaagggtttcaaatttggctggtctcagtcgggattccagtctgaa
atgggaactccaggtagcgaggatccgaacagcgattggcacgtctgggttcatgacagg
gagaacatagtctcacaggttgtcagtggagatttacccgaaaatggtccagggtactgg
gggaactataagagatttcatgacgaagcagagaaaataggactaaatgcagtgagaatt
aacgtagagtggagtagaatatttcccagaccactacccaagcctgaaatgcaaacaggg
actgataaagagaacagtcctgtcattagcgtagacttaaatgagtctaagctgagagaa
atggacaactacgctaatcatgaagcgttatcacattacaggcaaatactggaggatcta
agaaacagaggatttcacatagtactgaacatgtatcattggactttgcccatatggttg
cacgaccctatcagagtgaggagaggagactttacaggaccaacaggttggttaaactcc
aggacagtttatgagttcgctaggttctcggcttacgtagcctggaaattagatgatttg
gcgagtgaatatgcaacaatgaatgaacctaacgtggtttggggagcaggttacgctttt
cctagagcaggctttccacctaattaccttagcttcaggctttcagaaatagctaaatgg
aatataattcaggctcatgcgagggcttatgacgccatcaagagcgtatcaaaaaagagt
gtaggtataatatatgcaaacacatcatattacccactcagaccacaagataacgaagct
gtggaaatagcagagagattgaacagatggagtttctttgactccattataaagggagag
ataactagtgagggacaaaatgtcagagaggacttaaggaacaggttagactggattggc
gtaaactattacacgaggactgtggtaacaaaagctgagagtggttatttaacccttccg
ggttatggagatcgttgtgaaaggaactcattgagtttagctaacctccctaccagtgat
ttcggttgggagttctttcctgagggtctatatgatgtacttttgaagtattggaatagg
tatgggttaccattatacgtaatggagaacggtatcgctgatgacgctgactaccaaaga
ccgtattacttagtatcacatatctaccaggtgcacagggctttaaacgagggagtagat
gtaagaggttatcttcattggtctttggcagataattatgagtggtcgtcaggtttttca
atgaggttcggtctacttaaggtagattatctaacaaagagattgtactggagaccttct
gcattagtttacagggagattactaggagtaacggtattcctgaggagctggaacatcta
aacagagtaccaccaataaaacctttgagacattaa

DBGET integrated database retrieval system