KEGG   Sulfolobus acidocaldarius DSM 639: Saci_2062Help
Entry
Saci_2062         CDS       T00251                                 

Gene name
acs
Definition
(RefSeq) acetyl-coenzyme A synthetase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saci_2062 (acs)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saci_2062 (acs)
   00620 Pyruvate metabolism
    Saci_2062 (acs)
   00640 Propanoate metabolism
    Saci_2062 (acs)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saci_2062 (acs)
   00680 Methane metabolism
    Saci_2062 (acs)
Enzymes [BR:sai01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Saci_2062 (acs)
Lipid biosynthesis proteins [BR:sai01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Saci_2062 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1879438..1881123
Genome map
AA seq 561 aa AA seqDB search
MVEVIRDKKIVVEPNLTNYDEIYRNFNWDNARKTLNFVGKGNVSKLVMDLNADGKDKSGL
IWISEKGDIKSYTFHDLEVKASSFGAVLKDSGVKPGDRVVVMSKRVPSLYFSLLAIGMIG
AVIVPIYSTFGEEAIRYRVENSGSKVAIVHESLADKFRNISGIKILKTSEEGIVNEQNVH
NTSYVERSINDPTLILYTSGTTGRPKGIWHSQDIMTFYYFSGKYHFDMHAQDKFWHTGDP
AWVAGFAGVWTAWLNSIPIVSYEGKFDAESWYSNIERVKVTLMSTAPTAIRLLKKEGVEL
ARKFDLSSIRFIHAGGEYVDPDIIRWSMEVFGVPIHDGYGQTETATYVIANYVSMPIKIG
SMGKPLPGVKALVVDENGNPLPPNTKGILALDPDFPAMAKGIWNDEERWKNSFKNGYYLT
GDMGYIDEDGYFWYLGRADDIIKVSGYRISPVEIESVIMTHPAVAESAVIGVEDPIRGFR
IKAYIVLKKDYSPSDELKNEIINHVRVKLGAHVVPREVEIVKELPHTLSGKTMRRVLRAI
ESGSQLGDVSTLENPETVKKE
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggttgaagtaataagggacaagaagatagtagtggaaccaaatcttacaaattacgac
gaaatatacaggaattttaactgggataacgctagaaagacgctgaactttgtgggaaag
ggaaatgtctcaaagcttgttatggatctaaatgctgatggtaaagacaagagtgggttg
atatggatcagtgagaagggagatatcaagagttatacattccatgaccttgaagtgaaa
gcttcaagttttggggctgtcttgaaggactcaggtgtaaaacctggggacagggtggtt
gtaatgtccaaaagagtaccatcgctatatttttccctcttggctattggcatgattggg
gcagtcatagtccccatatattccacgttcggtgaggaggcaattaggtatagggttgag
aacagtggctctaaggtggcaattgtacatgaatcacttgctgataagtttaggaacatc
tcagggataaagatcttaaaaacgtcagaggaggggatagtgaacgaacagaatgtgcat
aacacgtcgtatgttgagaggtcaataaatgatcccacgttgatattgtacacttcaggg
acaactgggagaccaaagggaatatggcactcacaggacatcatgaccttctattacttc
tctggtaaataccactttgacatgcatgcacaggataagttttggcacacaggagatcct
gcatgggtcgccgggtttgcaggggtgtggacagcatggctaaacagcattccaatagtg
tcttacgagggaaaatttgacgcagagtcctggtactctaacatagagagggtgaaggtc
actctaatgtccactgcaccgaccgcgattagactactgaaaaaggagggtgttgagctc
gccagaaaattcgatctctcttcaatcagattcatacacgcaggaggggagtatgttgac
cctgacataataaggtggagtatggaggtctttggggtaccaattcatgacggatatggt
cagactgaaactgcaacttacgtcattgcaaactacgtttcgatgcccattaagataggg
tcaatgggtaaaccgcttccaggtgtaaaggcacttgtagtggacgaaaatggtaatccc
ctaccgcctaacaccaagggaatactggcattagatcctgactttccggctatggctaaa
ggtatatggaacgatgaggagaggtggaaaaacagtttcaagaacgggtattacttgact
ggtgatatgggctatatagacgaagacggctacttctggtaccttggaagggctgacgac
ataataaaggtttcagggtacaggatcagtccagttgaaattgaaagcgttataatgaca
cacccagcagtcgcagagtcagctgtcataggagttgaggacccaataaggggattcaga
ataaaggcatatatcgtgcttaagaaggactattccccgtcagatgagttgaagaacgag
ataatcaaccacgtgagagtaaagctaggagcccacgttgttcctagggaggtggagatt
gtgaaagagttgccacatactctgagtggtaagaccatgaggagggttttgagggcaatc
gagagtggttcacaactgggagatgtaagtacacttgagaacccagagacggtaaagaag
gaatga

DBGET integrated database retrieval system