KEGG   Sulfolobus acidocaldarius DSM 639: Saci_2126Help
Entry
Saci_2126         CDS       T00251                                 

Gene name
adh
Definition
NAD-dependent alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Saci_2126 (adh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saci_2126 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    Saci_2126 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    Saci_2126 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Saci_2126 (adh)
   00626 Naphthalene degradation
    Saci_2126 (adh)
Enzymes [BR:sai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Saci_2126 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1951596..1952621
Genome map
AA seq 341 aa AA seqDB search
MKAVRIHEYNKPLKLDDVPEPKISSPYDIIVKIKGAGVCRTDLHIQEGVWKDIFNPKLPF
TIGHENVGVVETKGDNVDWLNVGDQVILHPYITCRRCKACRSGNDMHCPNGKFPGLDGTD
GGYAEYLRTSAYSAIVVPKGVDLISMAPLADAGLTAYHAVKKVSKELTPGTFLVIIGVGG
LGHIGIQVAKAITSARIIAVDLDEDKLKMAKELGADYIVNGKEAIHEVRKITDNVGADVV
IDFVGEHNTPKDAVSMIKKGGTYSIVGYGGEFRDPTVDFISREISVLGNLVGTYNELSEL
VQLYVEGKVKVRVKTFSLDEANKALEELSKGLIPGRGVLKP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtgagaattcatgagtataacaagccattaaagttagatgatgtacctgaa
cccaagatatcatccccttatgatattatagtaaagattaagggagcaggagtttgcaga
actgacctacacattcaagagggagtttggaaggacatattcaatccaaaacttcctttt
accataggtcatgagaacgtgggagttgtggagactaaaggagataatgtagactggttg
aacgttggagaccaggtaatcctacatccatatataacatgcaggagatgtaaagcttgc
aggtctgggaatgacatgcattgccccaatggaaaatttcctggtctagacggtactgac
ggtggatatgccgaatatttgaggacatcagcctactcagcaattgtagtacctaagggt
gttgacctaatatcaatggctccacttgcagacgcaggcttgacagcttaccacgcagtc
aagaaggtgtctaaggaacttaccccaggcacatttttagtaataattggcgtaggtggt
ctggggcacataggaattcaagttgctaaagcgatcacgtcagccagaattatagcagta
gatctggatgaggataagctcaagatggctaaggagttaggagcagactacatagttaat
ggcaaggaagctattcatgaggtaagaaagatcaccgataacgtgggagccgatgtggtc
attgactttgttggagagcataatacgcccaaagacgctgtgtcaatgattaagaaggga
ggtacttattcaatagtgggatatggtggtgaattcagagatccaactgtagacttcatt
agtagggaaataagtgtgttagggaatttagtgggaacctataacgagttaagtgaattg
gtccaattatacgtggaaggtaaagtgaaagtaagagttaaaactttctccctggacgaa
gcaaataaagccttggaggagttaagtaaaggtttaattccagggagaggagtccttaag
ccataa

DBGET integrated database retrieval system