KEGG   Sulfolobus acidocaldarius DSM 639: Saci_2134Help
Entry
Saci_2134         CDS       T00251                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Saci_2134
Enzymes [BR:sai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Saci_2134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1961598..1962515
Genome map
AA seq 305 aa AA seqDB search
MRQIDALKSPRFTQVSTFGRLPMCLPQEEVKAAFLGIPFDDAVTYRTGARFGPMAVRQGS
RLLRPYNQFLDTYPFDKLNACDLGDVNIIPGYIEDTIKIIEKDVYDIISSKKLVPFIAGG
DHSITLPILRAMHKQYGKINLIHLDSHYDFWDTYWGKKYTHGSWLRRALEEGLLKDVIQA
GIRASTFSKEDLSDKVKLGIKSFTIRELKLNPKDILKEIESLKGPTYVSLDIDVVDPAFA
PGTGTPEVGGLSSFEIIEFIRQWRFDKLVGFDVVEVSPPYDVSEITSMLAANIIYEGLSI
LSLSL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagatcgatgctcttaaatccccaagatttacccaagtttccactttcggaaga
ctcccaatgtgtctaccacaggaagaggttaaagcggctttccttggaataccattcgac
gatgccgtaacatatagaacaggggctagatttggaccaatggctgtaagacaaggttca
aggttattaagaccttacaatcagttcttagatacatatccgtttgacaaactgaatgct
tgtgaccttggagatgtgaatataataccggggtatattgaggacaccataaagataata
gagaaagatgtatacgacattatatcatctaaaaagttagttccctttatagctggaggg
gaccactccataacacttcccatattaagagccatgcataagcaatatggtaagatcaac
ttaattcatttagactcccattatgacttctgggacacttactggggtaaaaagtataca
catggaagttggttgagaagagccctagaggagggtctactcaaagacgttattcaggct
ggcataagggcatctacattttcaaaggaggacttaagtgataaagttaagctaggaata
aagagtttcactatcagagaattaaaacttaatcctaaggatatattaaaggagatcgaa
tcacttaaaggacccacttacgtctcactcgatatagatgtagttgatccagcatttgcc
cctggcacagggactcctgaagttggaggtctatcgagctttgagataatagagttcata
aggcaatggagatttgacaaattagttggatttgatgtggtagaggtgtctccaccatac
gatgtcagtgagataacctcaatgctagcagctaacataatatatgagggactaagcatc
ttatcattgtccctttag

DBGET integrated database retrieval system