KEGG   Sulfolobus acidocaldarius DSM 639: Saci_2146Help
Entry
Saci_2146         CDS       T00251                                 

Definition
phenylacetyl-CoA ligase (EC:6.2.1.-)
Orthology
K14466  
4-hydroxybutyrate---CoA ligase (AMP-forming) [EC:6.2.1.40]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Carbon fixation pathways in prokaryotes
Microbial metabolism in diverse environments
Carbon metabolism
Module
Dicarboxylate-hydroxybutyrate cycle
Hydroxypropionate-hydroxybutylate cycle
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saci_2146
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saci_2146
Enzymes [BR:sai01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.40  4-hydroxybutyrate---CoA ligase
     Saci_2146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1976028..1977455
Genome map
AA seq 475 aa AA seqDB search
MNADSLHEYERIHKELVEEGFIRRDFPPNPSIKLWNERVMKMPRDELDKLKTVRLKRLVK
WAWENVEFYKRFWKNRGFYPEYIKDWRDIVKIPVLRKEDIRTDLQTHPPFGTIFHPDLAK
RIRFVGATSGSTGMPTFQGWGKLELDYFQEAQARYLWSFAGVRPGITYANYLNMSGFYSW
GPPVVETAMWRCGATTIAGGGETFFSWKQRHLLIFKLWKIDVFATTPWLHRLIGEMAIEE
GWETPFKVLLLHGGAAAENTKKRLFKVHPNAEMAINVWGTTDGHMAVELPNSRGELVIWE
DMEIFDVIDPKTNEPVSEGERGELIATLLNHFTMPLIRYSLGDYVKNEFITEPDPIFGIT
HARFVEPIPGRVEWMFRVKGKLLLPIYIEDAINEIPDTTGMFNIMVYAEEMEKLRIKIES
KRDRVDEAYDKSAKALLANKIGLDENDVEIEWIRPGEAVWTGYKLQVFVDQRKKR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagatagtttacatgaatatgaacgaatccacaaagaacttgtagaagaagga
ttcataagaagagattttcccccaaatccctccatcaaactatggaatgaaagagtaatg
aagatgcctagagacgagttagataagttaaagacagtaaggctaaagagactggttaaa
tgggcatgggagaatgtcgaattttacaagaggttttggaagaacaggggattctatcct
gagtacatcaaggactggagagatattgtgaaaattcctgtacttaggaaggaggatata
agaactgacttacagacacacccacctttcggaaccatatttcatccagacttagccaaa
aggataaggtttgttggtgcaacttcaggttccacaggaatgcccacatttcaaggatgg
gggaaactggaattagactattttcaggaagctcaggctaggtatctatggagtttcgct
ggagtaagaccaggtataacatacgccaactacttaaacatgagcgggttttacagttgg
ggtcctccggtagttgagacggcgatgtggagatgtggagctactacaattgctggggga
ggagagacgtttttctcctggaagcagagacatctgttaatattcaaactgtggaagata
gacgtctttgcaactacaccttggttacacagactaataggagaaatggcaatagaggaa
ggatgggaaactcccttcaaggttctgttattacatgggggtgcagctgctgaaaatacg
aagaagagactgtttaaggtacatcctaatgctgagatggcaataaacgtctggggaact
acagatggacatatggctgtagaattacccaactcaagaggagagcttgtgatatgggag
gatatggagatctttgatgtaatagacccaaagaccaatgaaccagtctctgagggcgag
aggggtgaattaatagcaactttacttaatcactttaccatgccactgattaggtacagt
ttaggtgattacgttaaaaatgagtttataactgaaccagaccctatcttcggtataact
catgccagatttgtagagcctataccagggagagtcgagtggatgttcagagtaaaggga
aaattgctgttgccaatatatattgaagacgcaataaatgaaatacctgatacgactgga
atgttcaacataatggtttatgcggaggagatggagaagctgaggataaagatagagagt
aagagagacagagtagatgaggcttacgataagtcagctaaagctttgctagccaataag
ataggattagacgaaaatgacgttgagatagaatggattagaccaggagaagctgtctgg
actggttataaattacaggtctttgtggatcaaagaaagaagaggtag

DBGET integrated database retrieval system