KEGG   Sulfolobus acidocaldarius DSM 639: Saci_2190Help
Entry
Saci_2190         CDS       T00251                                 

Gene name
mas
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saci_2190 (mas)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saci_2190 (mas)
   00630 Glyoxylate and dicarboxylate metabolism
    Saci_2190 (mas)
Enzymes [BR:sai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Saci_2190 (mas)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2027845..2030319
Genome map
AA seq 824 aa AA seqDB search
MPSKLKIPDEIYHNYKDLFGEKVINDRIVSVEGLIEELSVEFSDEIKRVISKRRKWLESK
DSVSSKGSFPSWDEVFVDADGNRRTFREIVQGMIDNFLQRQSSLSWRLNDHVPIPNDAHP
IKNPGLEITGPWYPLSRAYNQVNTDVTSAMEDEEDASPAWYTPYGSGKSIADVWDARKNV
KLFLSGKAPNPYYEKGKTYTLNKPRDKWPTIFHRLPGLHLLDFDITLDGKPVPAIIVSAV
IYTLNNYISLRNAGSGVYFYLPKTQTPEEALIVEKILRRIEEKLGLPIGTLKLALLYEEV
NAGRYFPVILWIFRERLIKSNNGRWDYLGSLIEMWLQERVLPDPQNITMTSPNMMAYQKY
NALIMLLAGAKNGEADAAPVGGMAAVMLYPQSDAFERHRYNLKALRGIKLDKLRERLIGL
IFIGDVKGKVTLEDILKGKVQGKLYDMFRQSWVATKEEAYVEAGNKPLKASLEELQKMID
APVEYVTVEGTKMPTVDSGLTPEERSLFQRLGLIDENGKITPWVITKDMIDTPEKLLHNK
ELWGGKSIWNALYDIPDGEITPEHVQHAFYMAANYGFQLLNGNLAAAIDDYELKQRFMND
LATYRIFTSWLWSLVNRDAVITKEGYIKAPKLTRDGVIPAENVLKVAKGTKVKDIFEEIW
KLHFDWTNEFYKEQDMRVANRLAETFGKTNNNSVVEEIYNIISKAYNAGPFRQMSAKEAA
EKIGKLLNTQPSKIEEELIKLAPRFDREMAPVIMEILMRQFLYPKYIMNSGKILFVLSPL
DPEKRLKVMDSIFSFREMVQDKVKRGELDPTVLELYDYIYDDYK
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
ttgccctccaaattaaaaattccagatgaaatatatcataactacaaagacctcttcggt
gaaaaagttataaatgacagaattgtaagcgttgaaggactaatagaggaactttctgta
gagttttccgacgagataaagagagtaattagtaagaggaggaaatggttagagtcaaag
gattcagtatcatcaaaggggtcatttccctcatgggacgaagtttttgtggacgcagat
ggtaataggaggacttttagagagatagtccaaggaatgatagacaatttcctccagaga
caatctagtttaagctggaggttaaatgatcatgtgcctataccaaatgatgcccatccg
atcaagaaccctggactagaaatcactggaccttggtatcctttaagtagggcttacaac
caggtaaacactgatgtaacatcagcaatggaagatgaagaggacgcctcacccgcctgg
tacactccctatggatcaggaaagagtatcgctgatgtttgggacgccagaaagaacgtt
aaacttttcctttcagggaaggcaccaaatccttattacgaaaagggtaaaacatacact
ttgaataagcccagagataagtggcctactatattccacaggctcccaggactacatcta
cttgactttgatattacactggacggaaaaccagtacctgcaatcatagtctcagctgta
atctatacacttaataattacataagccttaggaacgcaggctcgggagtctacttctac
ttacccaaaacacagacacccgaagaagctctaatcgtggaaaaaatactaagaagaatt
gaggagaagttagggttacctattggaacacttaaattagcgctattatatgaagaagtt
aatgccggaagatactttccagttatattgtggatatttagggagagactgataaagtcg
aataacggtagatgggattacctaggtagtctcatcgagatgtggttacaggagagggtt
cttcctgacccacaaaatataacaatgacttcgccgaacatgatggcttaccagaaatat
aatgcgttgataatgttactggcaggagcaaaaaatggtgaggctgacgctgcaccggtt
ggaggaatggctgccgtaatgctctatcctcaaagtgacgcttttgaaagacacagatat
aacttaaaggcattaagaggaattaaactggataaacttagagaaagactaataggactt
atctttataggagacgttaaagggaaggtaacacttgaagacatcttaaaagggaaagtc
caaggtaaactatatgacatgtttaggcaaagttgggtagctacaaaggaagaggcttat
gttgaggctggaaataaacccttaaaggctagcttagaggagttacaaaaaatgatagat
gctcctgttgagtacgtcacagtagagggtactaagatgcccactgttgacagtggactc
acacctgaggagaggtctttattccagagactaggtttaatagatgaaaatggcaaaata
acaccctgggttataactaaagatatgattgatacaccagagaagttacttcataataag
gagttatggggaggaaagagtatatggaatgccctttatgacataccagacggggagatt
acacctgagcatgtccaacacgcattttacatggcagcaaattatggtttccagttatta
aatggtaatttagcagcagcaatagatgattatgagcttaagcagaggttcatgaacgac
ttagctacttataggatatttacttcttggctgtggagcctggtgaacagggatgcagtg
atcacgaaagaaggatatattaaagctcctaaactaacaagggacggggtcatacctgca
gagaacgtactaaaagttgctaaaggtactaaggtaaaggatatatttgaggaaatatgg
aagttacatttcgattggactaatgaattttacaaggagcaggacatgagagttgccaat
agactggcagagacgtttggaaagactaataataactcagtagttgaagagatatacaat
ataatatcaaaggcatataacgcaggaccctttagacagatgtcggcaaaggaagctgca
gagaaaatcggtaaactgcttaacactcaaccttcaaagattgaagaggaattgataaag
cttgcacccagatttgacagggagatggcaccagttataatggaaattttaatgagacaa
tttctatatcctaaatacataatgaatagcggaaagatactatttgtgctctcgccatta
gatccagagaagaggttgaaggtaatggacagtatattctcgttcagggagatggttcaa
gataaggtaaaaagaggagagcttgatccaacagtgttggaactatatgactacatatac
gatgattataaatga

DBGET integrated database retrieval system