KEGG   Sulfolobus acidocaldarius DSM 639: Saci_2190Help
Entry
Saci_2190         CDS       T00251                                 

Gene name
mas
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saci_2190 (mas)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Saci_2190 (mas)
   00630 Glyoxylate and dicarboxylate metabolism
    Saci_2190 (mas)
Enzymes [BR:sai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Saci_2190 (mas)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2027845..2030319
Genome map
AA seq 824 aa AA seqDB search
MPSKLKIPDEIYHNYKDLFGEKVINDRIVSVEGLIEELSVEFSDEIKRVISKRRKWLESK
DSVSSKGSFPSWDEVFVDADGNRRTFREIVQGMIDNFLQRQSSLSWRLNDHVPIPNDAHP
IKNPGLEITGPWYPLSRAYNQVNTDVTSAMEDEEDASPAWYTPYGSGKSIADVWDARKNV
KLFLSGKAPNPYYEKGKTYTLNKPRDKWPTIFHRLPGLHLLDFDITLDGKPVPAIIVSAV
IYTLNNYISLRNAGSGVYFYLPKTQTPEEALIVEKILRRIEEKLGLPIGTLKLALLYEEV
NAGRYFPVILWIFRERLIKSNNGRWDYLGSLIEMWLQERVLPDPQNITMTSPNMMAYQKY
NALIMLLAGAKNGEADAAPVGGMAAVMLYPQSDAFERHRYNLKALRGIKLDKLRERLIGL
IFIGDVKGKVTLEDILKGKVQGKLYDMFRQSWVATKEEAYVEAGNKPLKASLEELQKMID
APVEYVTVEGTKMPTVDSGLTPEERSLFQRLGLIDENGKITPWVITKDMIDTPEKLLHNK
ELWGGKSIWNALYDIPDGEITPEHVQHAFYMAANYGFQLLNGNLAAAIDDYELKQRFMND
LATYRIFTSWLWSLVNRDAVITKEGYIKAPKLTRDGVIPAENVLKVAKGTKVKDIFEEIW
KLHFDWTNEFYKEQDMRVANRLAETFGKTNNNSVVEEIYNIISKAYNAGPFRQMSAKEAA
EKIGKLLNTQPSKIEEELIKLAPRFDREMAPVIMEILMRQFLYPKYIMNSGKILFVLSPL
DPEKRLKVMDSIFSFREMVQDKVKRGELDPTVLELYDYIYDDYK
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
ttgccctccaaattaaaaattccagatgaaatatatcataactacaaagacctcttcggt
gaaaaagttataaatgacagaattgtaagcgttgaaggactaatagaggaactttctgta
gagttttccgacgagataaagagagtaattagtaagaggaggaaatggttagagtcaaag
gattcagtatcatcaaaggggtcatttccctcatgggacgaagtttttgtggacgcagat
ggtaataggaggacttttagagagatagtccaaggaatgatagacaatttcctccagaga
caatctagtttaagctggaggttaaatgatcatgtgcctataccaaatgatgcccatccg
atcaagaaccctggactagaaatcactggaccttggtatcctttaagtagggcttacaac
caggtaaacactgatgtaacatcagcaatggaagatgaagaggacgcctcacccgcctgg
tacactccctatggatcaggaaagagtatcgctgatgtttgggacgccagaaagaacgtt
aaacttttcctttcagggaaggcaccaaatccttattacgaaaagggtaaaacatacact
ttgaataagcccagagataagtggcctactatattccacaggctcccaggactacatcta
cttgactttgatattacactggacggaaaaccagtacctgcaatcatagtctcagctgta
atctatacacttaataattacataagccttaggaacgcaggctcgggagtctacttctac
ttacccaaaacacagacacccgaagaagctctaatcgtggaaaaaatactaagaagaatt
gaggagaagttagggttacctattggaacacttaaattagcgctattatatgaagaagtt
aatgccggaagatactttccagttatattgtggatatttagggagagactgataaagtcg
aataacggtagatgggattacctaggtagtctcatcgagatgtggttacaggagagggtt
cttcctgacccacaaaatataacaatgacttcgccgaacatgatggcttaccagaaatat
aatgcgttgataatgttactggcaggagcaaaaaatggtgaggctgacgctgcaccggtt
ggaggaatggctgccgtaatgctctatcctcaaagtgacgcttttgaaagacacagatat
aacttaaaggcattaagaggaattaaactggataaacttagagaaagactaataggactt
atctttataggagacgttaaagggaaggtaacacttgaagacatcttaaaagggaaagtc
caaggtaaactatatgacatgtttaggcaaagttgggtagctacaaaggaagaggcttat
gttgaggctggaaataaacccttaaaggctagcttagaggagttacaaaaaatgatagat
gctcctgttgagtacgtcacagtagagggtactaagatgcccactgttgacagtggactc
acacctgaggagaggtctttattccagagactaggtttaatagatgaaaatggcaaaata
acaccctgggttataactaaagatatgattgatacaccagagaagttacttcataataag
gagttatggggaggaaagagtatatggaatgccctttatgacataccagacggggagatt
acacctgagcatgtccaacacgcattttacatggcagcaaattatggtttccagttatta
aatggtaatttagcagcagcaatagatgattatgagcttaagcagaggttcatgaacgac
ttagctacttataggatatttacttcttggctgtggagcctggtgaacagggatgcagtg
atcacgaaagaaggatatattaaagctcctaaactaacaagggacggggtcatacctgca
gagaacgtactaaaagttgctaaaggtactaaggtaaaggatatatttgaggaaatatgg
aagttacatttcgattggactaatgaattttacaaggagcaggacatgagagttgccaat
agactggcagagacgtttggaaagactaataataactcagtagttgaagagatatacaat
ataatatcaaaggcatataacgcaggaccctttagacagatgtcggcaaaggaagctgca
gagaaaatcggtaaactgcttaacactcaaccttcaaagattgaagaggaattgataaag
cttgcacccagatttgacagggagatggcaccagttataatggaaattttaatgagacaa
tttctatatcctaaatacataatgaatagcggaaagatactatttgtgctctcgccatta
gatccagagaagaggttgaaggtaatggacagtatattctcgttcagggagatggttcaa
gataaggtaaaaagaggagagcttgatccaacagtgttggaactatatgactacatatac
gatgattataaatga

DBGET integrated database retrieval system