KEGG   Sulfolobus acidocaldarius DSM 639: Saci_2191Help
Entry
Saci_2191         CDS       T00251                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sai01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sai00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2030804..2032117
Genome map
AA seq 437 aa AA seqDB search
MNIRDIWNEETRRIEQEWSEDPRWKGIKRNYTASDVVKLRGSVRIEYTLARLGAQKLWKL
LNTEPYVATFGALTGSQAVEMAKAGLKAIYVSGWQVAADNNLSNQTYPDLSLYPSNSVPN
LVRRLNNALLRADQISWSEGKRDVDYLLPIVADAEAGFGGPIHAFELTKAMIEAGAAGVH
FEDQLASEKKCGHLGGKVLIPTGAFIRVLNAARLASDVLGVPTILIARTDALNAAYLSND
IDERDTAFLTGKRTPEGYYEVKGGIEYTIARGLAYAPYADLLWFETSRPDLDEAKQFADA
IHAHFPGKMLAYNLSPSFNWKKFMDDSKIGKFIEELGDMGYKFQFITLAGWHLINYHTFT
LAKAYKNEGMLGYVRLQELEFQAQREGYTAVSHQREVGTEYFDLVLTIASGGNASTTAMK
GSTEAEQFVQVEQKARK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
ttgaatataagagatatatggaatgaggaaacaaggagaattgaacaggagtggtcagaa
gaccctagatggaaaggaattaagagaaattacacagcttctgatgtggtaaagttaaga
ggatctgttagaattgaatatactttagcaagattaggggctcaaaagttgtggaagtta
ttaaacactgagccctatgttgccacctttggtgccttaacaggctcccaagcggtggag
atggcaaaagcaggattaaaggctatatacgtaagcggatggcaagtggctgcagataat
aacttatcaaatcagacttatcctgatttaagcttatacccctctaatagtgtaccgaac
ctggtaaggaggttaaacaatgcgttattaagagcagaccaaatatcttggagtgaagga
aaacgagatgtagattacctattacctattgtagctgatgcagaggctggctttggtggt
cctattcatgcatttgaactaacaaaggctatgattgaagccggtgcagctggtgtacac
tttgaggatcagttagcttccgaaaagaaatgtggtcatttgggtggaaaagtactgatt
cccacaggtgcattcataagagtactaaatgcagctagactagcttcagatgtcttaggt
gtaccgacaatattaattgcaagaacagatgcgttaaacgctgcatacttatctaacgat
attgatgagagagatactgccttcttgactggaaaaagaactcccgaaggttattatgag
gttaaaggtggcatagaatacacaatcgcgaggggattagcctatgcgccttatgctgat
ttactgtggtttgagacatcacgcccagacttagatgaggctaagcaatttgcagacgct
atacacgcccatttcccaggaaaaatgttggcctataacctgtccccctctttcaactgg
aagaaatttatggacgactctaagattggtaagttcatagaggaattgggtgacatgggt
tacaagttccagttcataaccctagcaggctggcacttgataaactaccacacatttaca
ctagcaaaagcctacaagaacgaaggaatgctaggttacgtgaggttacaggagctggag
ttccaggctcaacgcgaaggatacaccgcagtcagccaccaaagagaagtaggaaccgaa
tacttcgacctagtactaacaatagcctccggaggaaacgcatcaaccacagcaatgaaa
ggatcaactgaagcagagcagttcgttcaagtagaacaaaaagcaagaaaatga

DBGET integrated database retrieval system