KEGG   Sulfolobus acidocaldarius DSM 639: Saci_2191Help
Entry
Saci_2191         CDS       T00251                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saci_2191 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Saci_2191 (aceA)
Enzymes [BR:sai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Saci_2191 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2030804..2032117
Genome map
AA seq 437 aa AA seqDB search
MNIRDIWNEETRRIEQEWSEDPRWKGIKRNYTASDVVKLRGSVRIEYTLARLGAQKLWKL
LNTEPYVATFGALTGSQAVEMAKAGLKAIYVSGWQVAADNNLSNQTYPDLSLYPSNSVPN
LVRRLNNALLRADQISWSEGKRDVDYLLPIVADAEAGFGGPIHAFELTKAMIEAGAAGVH
FEDQLASEKKCGHLGGKVLIPTGAFIRVLNAARLASDVLGVPTILIARTDALNAAYLSND
IDERDTAFLTGKRTPEGYYEVKGGIEYTIARGLAYAPYADLLWFETSRPDLDEAKQFADA
IHAHFPGKMLAYNLSPSFNWKKFMDDSKIGKFIEELGDMGYKFQFITLAGWHLINYHTFT
LAKAYKNEGMLGYVRLQELEFQAQREGYTAVSHQREVGTEYFDLVLTIASGGNASTTAMK
GSTEAEQFVQVEQKARK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
ttgaatataagagatatatggaatgaggaaacaaggagaattgaacaggagtggtcagaa
gaccctagatggaaaggaattaagagaaattacacagcttctgatgtggtaaagttaaga
ggatctgttagaattgaatatactttagcaagattaggggctcaaaagttgtggaagtta
ttaaacactgagccctatgttgccacctttggtgccttaacaggctcccaagcggtggag
atggcaaaagcaggattaaaggctatatacgtaagcggatggcaagtggctgcagataat
aacttatcaaatcagacttatcctgatttaagcttatacccctctaatagtgtaccgaac
ctggtaaggaggttaaacaatgcgttattaagagcagaccaaatatcttggagtgaagga
aaacgagatgtagattacctattacctattgtagctgatgcagaggctggctttggtggt
cctattcatgcatttgaactaacaaaggctatgattgaagccggtgcagctggtgtacac
tttgaggatcagttagcttccgaaaagaaatgtggtcatttgggtggaaaagtactgatt
cccacaggtgcattcataagagtactaaatgcagctagactagcttcagatgtcttaggt
gtaccgacaatattaattgcaagaacagatgcgttaaacgctgcatacttatctaacgat
attgatgagagagatactgccttcttgactggaaaaagaactcccgaaggttattatgag
gttaaaggtggcatagaatacacaatcgcgaggggattagcctatgcgccttatgctgat
ttactgtggtttgagacatcacgcccagacttagatgaggctaagcaatttgcagacgct
atacacgcccatttcccaggaaaaatgttggcctataacctgtccccctctttcaactgg
aagaaatttatggacgactctaagattggtaagttcatagaggaattgggtgacatgggt
tacaagttccagttcataaccctagcaggctggcacttgataaactaccacacatttaca
ctagcaaaagcctacaagaacgaaggaatgctaggttacgtgaggttacaggagctggag
ttccaggctcaacgcgaaggatacaccgcagtcagccaccaaagagaagtaggaaccgaa
tacttcgacctagtactaacaatagcctccggaggaaacgcatcaaccacagcaatgaaa
ggatcaactgaagcagagcagttcgttcaagtagaacaaaaagcaagaaaatga

DBGET integrated database retrieval system