KEGG   Sulfolobus acidocaldarius DSM 639: Saci_2205Help
Entry
Saci_2205         CDS       T00251                                 

Definition
NAD-dependent alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Saci_2205
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saci_2205
  Lipid metabolism
   00071 Fatty acid degradation
    Saci_2205
  Amino acid metabolism
   00350 Tyrosine metabolism
    Saci_2205
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Saci_2205
   00626 Naphthalene degradation
    Saci_2205
Enzymes [BR:sai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Saci_2205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2042988..2043923
Genome map
AA seq 311 aa AA seqDB search
MKAAVLTAYNSPFEIRKDVEPNGSGVVVDVAATGICGRDLVVWKGGFRNLKLPLILGHEI
VGYYKGKPVAVYPNLSCGNCEYCKAGKENLCENAKIIGEGEITGGYGEKVIAPEKNLIPL
PTEEMEKYAAALDPVATAIHSAKLANLNKDSKVLVTGAGGGVGVHLVQYLKHIGIKEVYG
LTSKVDKLKELGATPITQIKNEKFDAVFELVGSKTINDSLRSLKKEGTLVLIGNVEGEPI
TLLRPALTVMRQQKIVGSAAYTKEEYEEAIRIIGENKIKIIYESYELERINEAYRKLANR
EIFGRAVLKLR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagctgttcttacagcatataactcgccttttgaaatcagaaaagatgtagag
ccgaatggatcaggagttgtagttgatgtagcggctacaggtatttgtggacgagattta
gtggtatggaagggagggttcagaaatctgaaattaccactgatattaggtcacgagata
gtaggttattataagggaaaaccggtagctgtctatcctaacttatcctgtggaaattgt
gaatattgtaaagctggaaaagaaaacttgtgtgaaaacgcaaaaataataggggaagga
gagattacgggtggttatggagaaaaagtaattgcaccagaaaagaacttaatacctttg
ccaactgaagagatggagaagtatgctgctgcattggaccctgtagctactgccatacat
tcagctaagctagcgaatctaaacaaggacagtaaagtattagtaacaggagcaggagga
ggagtgggagttcacttagttcagtatctgaagcacataggtataaaggaggtttacgga
ttaacttccaaggttgacaaacttaaagaacttggagcaactccaataacacagataaag
aacgagaagtttgatgcggtatttgaacttgtgggctcaaagactataaatgactctctt
agatccctaaagaaagagggaactttagtgttaattgggaatgtcgagggagagccaata
acattactgcgaccagccttaacagttatgagacagcagaaaatagtaggatcagcagca
tatactaaggaagaatatgaagaggcaataaggataattggtgagaacaagattaaaata
atatatgagagttatgaactggaaaggatcaacgaagcttatagaaagctagccaatagg
gagatatttggaagggcagtgttgaaactaagataa

DBGET integrated database retrieval system