KEGG   Sulfolobus acidocaldarius DSM 639: Saci_2250Help
Entry
Saci_2250         CDS       T00251                                 

Gene name
porC
Definition
pyruvate/ketoisovalerate oxidoreductase common gamma subunit (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saci_2250 (porC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saci_2250 (porC)
   00020 Citrate cycle (TCA cycle)
    Saci_2250 (porC)
   00620 Pyruvate metabolism
    Saci_2250 (porC)
   00640 Propanoate metabolism
    Saci_2250 (porC)
   00650 Butanoate metabolism
    Saci_2250 (porC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saci_2250 (porC)
   00680 Methane metabolism
    Saci_2250 (porC)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Saci_2250 (porC)
Enzymes [BR:sai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Saci_2250 (porC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2092967..2093530
Genome map
AA seq 187 aa AA seqDB search
MLEIRFHGRGGQGVVTASHLLAEAAGYDNLYSSSFPIYGAERRGAEIEAYCRISDSQIRV
TSPIQEPDYVVVLDGSLLHLSNNVYRGLKSNSVILANYGSEIKTDKKIITVNATKVASEL
GLIRSGWPMVNVIMLGSLIKLTGMPSIESLEKAIRDEFDDKLAEINMKGVRKMYELVEGR
RYNVLTT
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgaaataagattccacggtagaggtggtcaaggtgtcgttacggcttctcaccta
ctggctgaagcagcaggttatgataacttatactcttcatcattccccatatacggggct
gagagaagaggagccgaaatagaggcatattgtagaatttctgatagtcaaatcagggtt
acgtctccaatacaggaacctgattacgttgtagttctagatggttccctcctacatctt
tcaaacaatgtttatagaggtctaaagtctaactccgtaattcttgctaactacggttct
gaaattaagacagataagaaaataattactgtaaacgctacaaaggtagcctcggaacta
ggcttaattagatcaggttggcctatggtaaatgtaataatgttaggttctttgatcaaa
cttactggaatgccaagtattgagtcacttgaaaaggcaattagagatgaatttgatgat
aagctagcagagatcaacatgaaaggagtaagaaagatgtatgaactagtagaggggagg
aggtacaatgtccttactacttga

DBGET integrated database retrieval system