KEGG   Sulfolobus acidocaldarius DSM 639: Saci_2250Help
Entry
Saci_2250         CDS       T00251                                 

Gene name
porC
Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductases common gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
sai00010  Glycolysis / Gluconeogenesis
sai00020  Citrate cycle (TCA cycle)
sai00620  Pyruvate metabolism
sai00640  Propanoate metabolism
sai00650  Butanoate metabolism
sai00680  Methane metabolism
sai00720  Carbon fixation pathways in prokaryotes
sai01100  Metabolic pathways
sai01120  Microbial metabolism in diverse environments
sai01130  Biosynthesis of antibiotics
sai01200  Carbon metabolism
Module
sai_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saci_2250 (porC)
   00020 Citrate cycle (TCA cycle)
    Saci_2250 (porC)
   00620 Pyruvate metabolism
    Saci_2250 (porC)
   00640 Propanoate metabolism
    Saci_2250 (porC)
   00650 Butanoate metabolism
    Saci_2250 (porC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saci_2250 (porC)
   00680 Methane metabolism
    Saci_2250 (porC)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Saci_2250 (porC)
Enzymes [BR:sai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Saci_2250 (porC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: AAY81536
UniProt: Q4J6P4
Position
2092967..2093530
Genome map
AA seq 187 aa AA seqDB search
MLEIRFHGRGGQGVVTASHLLAEAAGYDNLYSSSFPIYGAERRGAEIEAYCRISDSQIRV
TSPIQEPDYVVVLDGSLLHLSNNVYRGLKSNSVILANYGSEIKTDKKIITVNATKVASEL
GLIRSGWPMVNVIMLGSLIKLTGMPSIESLEKAIRDEFDDKLAEINMKGVRKMYELVEGR
RYNVLTT
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgaaataagattccacggtagaggtggtcaaggtgtcgttacggcttctcaccta
ctggctgaagcagcaggttatgataacttatactcttcatcattccccatatacggggct
gagagaagaggagccgaaatagaggcatattgtagaatttctgatagtcaaatcagggtt
acgtctccaatacaggaacctgattacgttgtagttctagatggttccctcctacatctt
tcaaacaatgtttatagaggtctaaagtctaactccgtaattcttgctaactacggttct
gaaattaagacagataagaaaataattactgtaaacgctacaaaggtagcctcggaacta
ggcttaattagatcaggttggcctatggtaaatgtaataatgttaggttctttgatcaaa
cttactggaatgccaagtattgagtcacttgaaaaggcaattagagatgaatttgatgat
aagctagcagagatcaacatgaaaggagtaagaaagatgtatgaactagtagaggggagg
aggtacaatgtccttactacttga

DBGET integrated database retrieval system