KEGG   Sulfolobus acidocaldarius DSM 639: Saci_2253Help
Entry
Saci_2253         CDS       T00251                                 

Gene name
porB
Definition
pyruvate ferredoxin oxidoreductase subunit beta (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
sai  Sulfolobus acidocaldarius DSM 639
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:sai00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Saci_2253 (porB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Saci_2253 (porB)
   00020 Citrate cycle (TCA cycle)
    Saci_2253 (porB)
   00620 Pyruvate metabolism
    Saci_2253 (porB)
   00640 Propanoate metabolism
    Saci_2253 (porB)
   00650 Butanoate metabolism
    Saci_2253 (porB)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Saci_2253 (porB)
   00680 Methane metabolism
    Saci_2253 (porB)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Saci_2253 (porB)
Enzymes [BR:sai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Saci_2253 (porB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2094939..2095829
Genome map
AA seq 296 aa AA seqDB search
MTLGLREILNKHNSLISGTAACPGCPENMAMRMLGMGLGKDTVVVVVAGCSSIIQGNAPY
NSYNLPVVNIAFAAGPAAASGLARAYKQKGKDVNVVVWAGDGGTADIGFASLSGAAERNE
DIIYVCVDNEAYMNSGGQRSGSTPLGAITSTTPEGKKENKKNLPFLMVSHNVPYVATASV
GYPHDYIQKLKRAKEIDGFRYIHVLTPDPYGWLFDPSRTAEIAKLAVQTCYWPLFEYYNG
KITVSQECLHCLDKRTRRPIKDFLSVQGRFKRVKEDDIAKLEKYIDDMWEKIKELM
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttgacgttaggactccgagagatattgaataaacacaattcacttatatcaggtacagca
gcctgtcctggatgcccagaaaatatggcaatgagaatgttggggatgggactaggaaag
gatacggtagttgtagttgtagcaggctgctcatccataatacaaggtaatgcaccttat
aattcctataatttacctgtagtaaacatagcatttgcagctggtcctgcagctgcgtca
ggacttgctagagcatataaacaaaagggtaaggatgtgaacgtggtagtatgggctggg
gatggagggactgcagatataggatttgcgtcattaagtggtgctgcagagagaaatgag
gatataatctacgtatgtgtggacaatgaagcctatatgaacagtggaggacagagaagt
ggttccacgccattgggcgcaataacttctaccaccccagaaggcaagaaagaaaataaa
aagaaccttcccttccttatggtatctcacaacgtgccttatgttgctacagcaagtgta
gggtatcctcacgattatattcagaagttaaaaagagcaaaggaaattgatggctttagg
tatatacatgtgcttacccccgatccatatggatggctatttgacccatcgaggactgct
gaaatagctaagttagcagtgcagacgtgttattggccgttatttgaatattacaatggt
aaaataacagtaagtcaagagtgtcttcactgtttagacaagaggacaagaagaccaatt
aaggactttctgtctgtgcagggtagatttaagagagtaaaggaagatgatatagccaaa
ctggagaaatatatagatgatatgtgggaaaagataaaggagctaatgtaa

DBGET integrated database retrieval system