KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA): SaurJH9_0153Help
Entry
SaurJH9_0153      CDS       T00522                                 

Definition
aldehyde dehydrogenase
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA)
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:saj00010]
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:saj00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:saj00053]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:saj00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:saj00640]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:saj00071]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:saj00561]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:saj00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:saj00310]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:saj00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:saj00340]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:saj00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:saj00410]
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:saj00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
179028..180515
Genome map
AA seq 495 aa AA seqDB search
MAVNVRDYIAENYGLFINGEFVKGSSDETIEVTNPATGETLSHITRAKDKDVDHAVKVAQ
EAFESWSLTSKSERAQMLRDIGDKLMAQKDKIAMIETLNNGKPIRETTAIDIPFAARHFH
YFASVIETEEGTVNDIDKDTMSIVRHEPIGVVGAVVAWNFPMLLAAWKIAPAIAAGNTIV
IQPSSSTPLSLLEVAKIFQEVLPKGVVNILTGKGSESGNAIFNHDGVDKLSFTGSTDVGY
QVAEAAAKHLVPATLELGGKSANIILDDANLDLAVEGIQLGILFNQGEVCSAGSRLLVHE
KIYDQLVPRLQEAFSNIKVGDPQDEATQMGSQTGKDQLDKIQSYIDAAKESDAQILAGGH
RLTENGLDKGFFFEPTLIAVPDNHHKLAQEEIFGPVLTVIKVKDDQEAIDIANDSEYGLA
GGVFSQNITRALNIAKAVRTGRIWINTYNQVPEGAPFGGYKKSGIGRETYKGALSNYQQV
KNIYIDTSNALKGLY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaaacgttcgagattatattgcagagaattatggtttatttatcaatggggaa
tttgttaaaggtagcagtgacgaaacaatcgaagtgactaatccagcaactggagaaaca
ctatcacatattacaagagcaaaagataaagatgtcgatcatgcagtcaaagtggcgcaa
gaggcatttgaatcatggtcattaacttctaaatcagaacgtgcacaaatgttgcgtgat
attggtgataaattaatggcacaaaaagataaaattgcaatgattgaaacattaaataat
ggtaaaccgattcgtgagacaacagcaattgatattccatttgctgcaagacatttccat
tatttcgcaagtgttattgaaacagaagaaggtacagtaaatgatatcgataaagacaca
atgagtatcgtacgacatgagccgattggcgtcgtaggtgctgttgttgcttggaacttc
ccaatgctattagctgcatggaagattgcgccagccattgctgcaggtaatacaattgtg
attcaaccttcgtcttcaacaccattaagtttattggaagttgctaaaattttccaagag
gtattacctaaaggtgttgtcaatatactaacgggtaaaggttcagaatcaggtaatgca
attttcaatcatgatggtgtagataaattatcatttacgggctcaactgatgtaggttat
caagttgccgaagctgcagcaaaacatctagtacccgctacattagagcttggtggtaaa
agcgccaatatcatattagatgatgctaatttagaccttgcagttgaaggtattcagtta
ggtattttattcaaccaaggtgaagtatgtagtgcaggttctcgattattagttcatgaa
aaaatttatgatcaattggtgccacgtttacaagaggcattttcaaatattaaagttgga
gatccacaagatgaagctacacaaatgggtagtcaaactggtaaggatcaattagataaa
attcaatcatatattgatgcagcaaaagaatcagatgcacaaattttagcaggtggtcat
cgcttaactgaaaatggattagataaagggttcttctttgagccgacattaattgctgtg
ccagacaatcatcacaaattagcacaagaagaaatatttggaccagtgttaacagtgatt
aaagtgaaggacgatcaagaagcaattgatatagctaatgattctgagtatggtttagca
ggcggtgtattttctcaaaatatcacacgtgcattaaatattgctaaagctgtacgtaca
ggacgtatttggattaacacttacaaccaagtaccagaaggcgcaccatttggtggttat
aaaaaatcaggtatcggtcgagaaacttataaaggtgcgttaagtaactatcaacaagtt
aaaaatatttatattgatacaagcaatgctttaaaaggtttgtactag

DBGET integrated database retrieval system