KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA): SaurJH9_0516Help
Entry
SaurJH9_0516      CDS       T00522                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA)
Pathway
saj00900  Terpenoid backbone biosynthesis
saj01100  Metabolic pathways
saj01110  Biosynthesis of secondary metabolites
saj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SaurJH9_0516
Enzymes [BR:saj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SaurJH9_0516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABQ48320
JGI: SaurJH90516
UniProt: A5IQ47
Position
559396..560244
Genome map
AA seq 282 aa AA seqDB search
MIYETAPAKINFTLDTLFKRNDGYHEIEMIMTTVDLNDRLTFHKRKDRKIVVEIEHNYVP
SNHKNLAYRAAQLFIEQYQLKQGVTISIDKEIPVSAGLAGGSADAAATLRGLNRLFDIGA
SLEELALLGSKIGTDIPFCIYNKTALCTGRGEKIEFLNKPPSAWVILAKPNLGISSPDIF
KLINLDKRYDVHTKMCYEALENRDYQQLCQSLSNRLEPISVSKHPQIDKLKNNMLKSGAD
GALMSGSGPTVYGLARKESQAKNIYNAVNGCCNEVYLVRLLG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgatatatgaaacggcaccagccaaaattaattttacgctcgatacactttttaaaaga
aatgatggctatcatgagattgaaatgataatgacaacagttgatttaaatgatcgttta
acttttcataaaagaaaagatcgaaagatagttgttgagattgaacataattatgtgcct
tctaatcataaaaatctcgcatatcgtgcagcgcaactatttattgagcaatatcaacta
aagcaaggtgtaacaatttctatcgataaagaaatacctgtttctgctggcttagctgga
ggttcggctgatgcagcagcaacgttaagaggattgaatcgactttttgatataggggcg
agtttggaagaattggctctactaggcagtaaaattgggacagatattccgttttgtatt
tataataaaactgcactatgtactggaagaggagagaaaatcgagtttttaaataaacca
ccttcagcttgggtgattcttgctaaaccaaacttaggcatatcatcaccagatatattt
aagttgatcaatttagataagcgttacgacgtacatacgaaaatgtgttatgaggcctta
gaaaatcgagattatcaacaattatgtcaaagtttgtctaatcgattagagccaatttct
gtttcaaaacacccacaaatcgataaattaaaaaataatatgttgaaaagtggtgcagat
ggtgcgttaatgagtggaagcggaccgactgtgtatgggctagcacgaaaagaaagccaa
gcaaaaaatatttataatgcagttaacggttgttgtaatgaagtgtacttagttagacta
ttaggatag

DBGET integrated database retrieval system