KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA): SaurJH9_0804Help
Entry
SaurJH9_0804      CDS       T00522                                 

Definition
esterase/lipase-like protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA)
Brite
Enzymes [BR:saj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SaurJH9_0804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
881898..882638
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEI
LKSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
KTEGAIYEGFLEYARNFKKYEGKNQETIDNEMDHFKPTETLKELSEALDTIKDQVDEVFD
PILVIQVENDNMIDPQSANYIYDHVDSDDKDIKWYSQSGHVITIDKEKEQVFEDIYQFLE
SLDWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcagataaaattaccaaaacctttcttttttgaagaaggcaaacgtgccgtgttatta
ttacatggatttacaggcaattcgtctgatgtacgtcaattaggtcgatttttacaaaaa
aagggatatacttcgtatgcaccacaatatgaaggtcacgcggcaccaccagaggaaata
ctgaaatctagtcctttcgtttggtttaaagatgcgttagatggttatgattatcttgtt
gaacaaggttatgatgaaattgttgttgctggtctatcattaggtggggattttgcttta
aaattaagcttaaatagagatgtaaagggtattgtaacgatgtgtgcaccaatgggtggc
aaaactgaaggtgccatttatgaaggctttttagagtatgcacgtaattttaaaaagtat
gaaggtaaaaatcaagagactattgataatgaaatggatcattttaaaccaactgaaact
ttaaaagaactaagtgaagcattagatacgattaaagatcaagttgatgaggtatttgac
ccaattttagtgattcaagtagaaaacgacaatatgattgatccacaatccgcaaattat
atatatgaccatgtagattctgatgacaaagacatcaagtggtatagtcaatcaggacat
gttattacgattgataaagaaaaagaacaagtatttgaagatatttatcaatttttagag
tcattagactggtcagaataa

DBGET integrated database retrieval system