KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA): SaurJH9_1359Help
Entry
SaurJH9_1359      CDS       T00522                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:saj00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1422219..1423715
Genome map
AA seq 498 aa AA seqDB search
MEKYILSIDQGTTSSRAILFNQKGEIAGVAQREFKQYFPQSGWVEHDANEIWTSVLAVMT
EVINENDVRADQIAGIGITNQRETTVVWDKHTGRPIYHAIVWQSRQTQSICSELKQQGYE
QTFRDKTGLLLDPYFAGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGKAAHIT
DYSNASRTLMFNIHDLEWDDELLELLTVPKNMLPEVKPSSEIYGKTIDYHFYGQEVPIAG
VAGDQQAALFGQACFECGDVKNTYGTGGFMLMNTGDKAVKSESGLLTTIAYGIDGKVNYA
LEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDSEAR
GAIFGLTRGTEKEHFIRATLESLCYQTRDVMEAMSKDSGIDVQSLRVDGGAVKNNFIMQF
QADIVNTSVERPEIQETTALGAAFLAGLAVGFWESKDDIAKNWKLEEKFDPKMDEGEREK
LYRGWKKAVEATQVFKTE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatattttatctatagaccaaggaacaacaagctcaagagcgattttattc
aatcaaaaaggggaaattgcaggggtagcacaacgtgagtttaagcaatattttccacaa
tcaggttgggttgaacatgatgcaaatgaaatttggacatctgtgttagctgtaatgacg
gaagtaattaatgaaaatgatgttagagctgatcaaattgcaggaatcggtattacaaac
caacgtgaaacaacggttgtttgggacaaacatactggccgcccaatttatcacgcaatt
gtttggcaatcacgtcaaacacaatcaatttgttcagaattaaaacaacaaggatatgaa
caaacatttagagataagacaggattacttttagatccgtattttgcaggtacaaaagtt
aaatggattctagacaatgttgaaggtgcacgagaaaaagcagaaaatggcgatctatta
tttggaacgattgatacttggttagtatggaaattatcaggaaaagctgcgcatattact
gattattcaaatgcgagtcgtacattaatgtttaatatccatgatttagaatgggacgat
gagttattagaactacttacagtacctaaaaatatgttgccagaagttaaaccttcaagt
gaaatatatggtaagacaattgattaccacttctatggtcaagaagtaccaatcgctggt
gtagctggtgatcaacaagcagcattatttggacaagcttgcttcgaatgtggtgacgtg
aaaaacacatatggaactggtggcttcatgttaatgaatacaggtgacaaagcggttaaa
tctgaaagtggtttattaacaacaattgcttatggtattgatggaaaagtaaattatgcg
cttgaaggttccatctttgtttcgggttcagcaatccaatggttacgtgatggattaaga
atgattaattcagcaccacaatcagaaagttatgcgacacgagttgactctactgagggt
gtttatgttgttccagcttttgtaggtttaggaacaccatattgggattctgaagcacgt
ggtgcgattttcggtttaacacgtggaactgaaaaagagcactttatccgtgcaacttta
gaatcattatgttaccaaactcgtgacgttatggaagcaatgtcaaaagactctggtatt
gatgtccaaagtttacgtgtcgatggtggtgcagttaaaaataactttattatgcagttc
caagcagacattgttaatacttctgttgaaagacctgaaattcaagaaactacagcttta
ggtgctgcatttttagcaggtttagcagttggattctgggagagtaaagatgatatcgct
aaaaactggaaattagaagaaaaattcgatccgaaaatggatgaaggcgaaagagaaaaa
ttatatagaggttggaaaaaagctgttgaagcaacacaagtttttaaaacagaataa

DBGET integrated database retrieval system