KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA): SaurJH9_1755Help
Entry
SaurJH9_1755      CDS       T00522                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:saj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SaurJH9_1755
   01230 Biosynthesis of amino acids
    SaurJH9_1755
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SaurJH9_1755
   00030 Pentose phosphate pathway
    SaurJH9_1755
   00051 Fructose and mannose metabolism
    SaurJH9_1755
   00052 Galactose metabolism
    SaurJH9_1755
  Energy metabolism
   00680 Methane metabolism
    SaurJH9_1755
Enzymes [BR:saj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SaurJH9_1755
Protein phosphatases and associated proteins [BR:saj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SaurJH9_1755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1860792..1861760)
Genome map
AA seq 322 aa AA seqDB search
MKKIAVLTSGGDSPGMNAAVRAVVRTAIYNEIEVYGVYHGYQGLLNDDIHKLELGSVGDT
IQRGGTFLYSARCPEFKEQEVRKVAIENLRKRGIEGLVVIGGDGSYRGAQRISEECKEIQ
TIGIPGTIDNDINGTDFTIGFDTALNTIIGLVDKIRDTASSHARTFIIEAMGRDCGDLAL
WAGLSVGAETIVVPEVKTDIKEIADKIEQGIKRGKKHSIVLVAEGCMTAQDCQKELSQYI
NVDNRVSVLGHVQRGGSPTGADRVLASRLGGYAVDLLMQGETAKGVGIKNNKIVATSFDE
IFDGKDHKFDYSLYELANKLSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattgcagttttaactagtggtggagattcacctggaatgaatgctgccgta
agagcagttgttcgtacagcaatttacaatgaaattgaagtttatggtgtgtatcatggt
taccaaggattgttaaatgatgatattcataaacttgaattaggatcagttggggatacg
attcagcgtggaggtacattcttgtattcagcaagatgtccagagtttaaggagcaagaa
gtacgtaaagttgcaatcgaaaacttacgtaaaagagggattgagggccttgtagttatt
ggtggtgacggtagttatcgcggtgcacaacgcatcagtgaggaatgcaaagaaattcaa
actatcggtattcctggtacgattgacaatgatatcaatggtactgattttacaattgga
tttgacacagctttaaatacgattattggcttagtcgacaaaattagagatactgcgtca
agtcacgcacgaacatttatcattgaagcaatgggccgtgattgtggagatctagcatta
tgggctggattatcagttggtgctgagacaattgtagttccagaagtgaaaacagatatt
aaagaaatagctgataaaattgaacaaggtattaaacgtggtaagaaacactcaatcgtt
cttgtagcagaaggttgcatgactgcgcaagattgtcaaaaagaattatcacaatacatc
aatgttgataatagagtgtctgtgttaggtcacgttcaacgtggtggtagcccaacaggt
gcggatagagttttagcatcacgtttaggtggatatgcggtagacttattaatgcaaggt
gaaacagctaagggtgttggaattaagaacaataaaattgtagcaacatcttttgatgaa
atttttgatggtaaagatcataaatttgattatagtctatatgaacttgctaacaagtta
tctatataa

DBGET integrated database retrieval system