KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA): SaurJH9_1792Help
Entry
SaurJH9_1792      CDS       T00522                                 

Definition
bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase
Orthology
K13853  
3-deoxy-7-phosphoheptulonate synthase / chorismate mutase [EC:2.5.1.54 5.4.99.5]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:saj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SaurJH9_1792
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SaurJH9_1792
Enzymes [BR:saj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     SaurJH9_1792
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     SaurJH9_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1908959..1910050)
Genome map
AA seq 363 aa AA seqDB search
MSNKLESYRSEIVSLNHQILDLLSKRGELAQKIGEEKLKQGTRIYDPQREKEMLNDLIDS
NKGPFNDNTIKQLFKEIFKASTDLQKSENEKHLYVSRKLKPEDTIVTFDNGGIIGDGNKS
FVFGPCSVESFEQVEAVAKNLHAKGEKFIRGGAFKPRTSPYDFQGLGVEGLKILKQIKDK
YDLNVVSEIVNPNDFEVADEYLDVFQIGARNMQNFELLKEAGRTKKPILLKRGLSATIEE
FVYAAEYIASQGNQNIILCERGIRTYEKATRNTLDISAVPILKQGTHLPVMVDVTHSTGR
KDIMLPTAKAALAVGADGVMAEVHPDPSVALSDAGQQMDLDEFQAFYDELKPLADLYNAK
KLK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagtaataaattagaatcatacagaagtgagattgtctcactgaatcatcaaatttta
gatttattatctaaacgtggtgaactagcacaaaaaattggggaggaaaaattaaaacaa
ggtacacgtatctatgatccacaacgcgaaaaagaaatgcttaacgacttaattgatagc
aacaaaggaccatttaacgataatacaattaagcaattatttaaagaaatttttaaagcc
tctacagatttacaaaaatctgaaaatgaaaaacacttatacgtatcacgtaagttgaaa
cctgaagatacgattgtaacatttgataatgggggcattattggagacggcaataaatca
tttgtatttgggccatgttcagttgaatcatttgaacaagttgaagctgttgctaaaaac
ttacatgctaaaggtgaaaaatttattcgtggcggtgcatttaaaccacgtacatcacca
tatgatttccaaggcctaggtgttgaaggacttaaaatacttaaacagattaaagataaa
tatgatttaaatgttgtcagcgaaatcgtaaatccaaatgattttgaagtggctgatgag
tatttagacgtattccaaattggtgcacgtaatatgcaaaacttcgagttattaaaagaa
gctggccgtacgaaaaagcctattctattaaaacgtggtttatctgctacaatcgaagag
tttgtttatgcagctgaatacattgcttcacaaggtaatcaaaacattattttatgtgaa
cgtggaatccgaacttatgaaaaggcgacacgtaacactttagatatttcagcagtacca
attttaaaacaaggtacacacttaccagtcatggtagatgttacgcatagtacaggtcgt
aaagatatcatgttaccaactgcgaaagcagcattagcagttggtgctgatggagttatg
gctgaggtgcatccagatccatctgttgcacttagtgatgcgggtcaacaaatggattta
gatgaattccaagcattttatgatgaattaaagcctttagctgatttatataacgctaaa
aagttaaaataa

DBGET integrated database retrieval system