KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA): SaurJH9_1885Help
Entry
SaurJH9_1885      CDS       T00522                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA)
Pathway
saj00860  Porphyrin and chlorophyll metabolism
saj01100  Metabolic pathways
saj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SaurJH9_1885
Enzymes [BR:saj01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SaurJH9_1885
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     SaurJH9_1885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 MCRA Pyr_redox HI0933_like NAD_binding_9 Thi4 FAD_binding_2 Mqo FMO-like FAD_binding_3 Glu_dehyd_C Prenylcys_lyase Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ABQ49670
JGI: SaurJH91885
Position
complement(2006117..2007517)
Genome map
AA seq 466 aa AA seqDB search
MTKSVAIIGAGITGLSSAYFLKQQDPNIDVTIFEASNRPGGKIQSYRKDGYMIELGPESY
LGRKTIMTELAKDIGLEQDIVTNTTGQSYIFAKNKLYPIPGGSIMGIPTDIKPFVTTKLI
SPLGKLRAGLDLIKKPIQMQDGDISVGAFFRARLGNEVLENLIEPLMGGIYGTDIDKLSL
MSTFPNFKEKEEAFGSLIKGMKDEKNKRLKQRQLYPGAPKGQFKQFKHGLSSFIEALEQD
VKNKGVTIRYNTSVDDIITSQKQYKIVYSNQQEDVFDGVLVTTPHQVFLNWFGQDPAFDY
FKTMDSTTVATVVLAFDEKDIENTYDGTGFVIARTSDTDITACTWTSKKWPFTTPEGKVL
IRAYVGKPGDTVVDDHTDNELVSIVRRDLSQMMTFKGDPEFTIVNRLPKSMPQYHVGHIQ
QIRQIQAHIKQTYPRLRVTGASFEAVGLPDCITQGKVAAEEVIAEL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgactaaatcagtggctattataggagcggggataacaggtttatcaagtgcatatttt
ttaaaacagcaagatcctaatattgatgtaaccatctttgaagcatcgaatcgtccgggg
ggaaagattcaatcgtatcgtaaagatggttatatgattgaactagggcctgaatcttat
ttaggtagaaaaacgattatgacagaattagcgaaagatattggattagaacaagatatt
gttacaaatacgactggacaatcatatatttttgcgaaaaataaattatatccgattcca
ggtggttcaattatgggtattccaacagatattaaaccatttgttactacaaaattaata
tcgccacttggtaaattaagagcaggattagatttaatcaaaaagcctatacaaatgcaa
gatggtgacatttctgttggtgcatttttcagagcaagattaggtaatgaggtacttgag
aacttaattgagcctttaatgggtggtatttatggtaccgatattgataaattaagtttg
atgagtacgtttcctaattttaaagaaaaagaagaggcattcggaagtctgataaaaggt
atgaaggatgagaaaaataagcgtctgaaacaaagacaattatatcctggcgcaccaaaa
ggacaattcaaacaatttaagcatggtttaagctcatttattgaagcattagaacaagat
gtgaaaaataaaggtgtgacaatacgctacaatacgtcagtggatgatattattacatct
caaaagcaatataaaattgtttacagtaatcaacaagaagatgtattcgatggggtatta
gtgacaacaccgcatcaagtctttttgaattggttcggacaagatccagcatttgattac
tttaaaacgatggatagtacgactgttgcaactgttgtattggcatttgatgaaaaagac
attgaaaatacttatgatggtactggcttcgtgattgcgagaacgagtgatacagacatt
accgcatgtacttggacatcgaaaaaatggccatttactacaccagaaggtaaggttttg
attcgtgcgtatgtaggtaaaccaggtgatactgtggttgatgatcatacagataatgaa
ttagtatcgattgtacgtagagatttaagtcaaatgatgacatttaaaggtgatcctgaa
tttacaattgtcaatcgtttgccgaaaagtatgccacagtaccatgtcggtcatattcaa
caaattagacagattcaagcacatattaaacaaacatatccacgacttagagtaactggt
gcatcttttgaagcggttggactacctgattgtattacacaaggtaaagttgctgctgaa
gaagtaatcgcagagttgtaa

DBGET integrated database retrieval system