KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA): SaurJH9_2482Help
Entry
SaurJH9_2482      CDS       T00522                                 

Definition
(GenBank) Cellulase
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
complement(2622515..2623591)
Genome map
AA seq 358 aa AA seqDB search
MNQSVKLLKHLTDVNGIAGYEMQVKEAMRNYIEPVSDQIIEDNLGGIFGKKNAENGQYSI
MISGHMDEVGFMVTKIDKHGFISFTPVGGWWNQVMLSQKVTITTDSGKEIRGIIGSKPPH
VLTPEERKKPMEIKNMFIDIGVSSKEEAEEAGVEVGNMVTPYSEFEVLANDKYLTAKAFD
NRYGCALAVEVLKRLKDENIGINLYSGATVQEEVGLRGAKVAANTIKPDLAIAVDVGIAY
DTPGMSGQTSDSKLGGGPVVIMMDATSIAHQGLRKHIKDVAKEHNIEVQWDTTPGGGTDA
GSIHVANEGIPTMTIGVTLRYMHSNVSVLNVDDYENSIRLVTEIVRSLNDESYKNIMW
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtcagtcaaattacttaaacatttaacagatgtaaacggcattgctggttat
gaaatgcaagttaaagaagcaatgcgtaactatatagagcctgtcagtgatcaaattatt
gaagataacttgggtggcatttttggaaagaaaaatgctgagaatggtcaatactcaatt
atgatttctggtcatatggatgaagttggttttatggtaacaaagattgataaacatggt
tttatttcatttacgccagttggtggatggtggaatcaagtcatgctatctcaaaaagta
acgattacaacagattcgggcaaagaaattagaggtatcatcggttctaaaccgccacat
gtcttaacgcctgaagaacgtaaaaagccaatggaaatcaaaaatatgtttatagatatt
ggtgttagtagcaaggaagaagctgaagaagctggcgttgaagtaggcaatatggtaacg
ccatatagtgaatttgaagtgcttgcaaatgataaatatttaactgcgaaagcatttgat
aatcgctatggctgtgcattagctgttgaggtattaaaacgtttaaaagatgaaaatatt
ggaattaacttatacagtggtgccacagtgcaagaagaagttggtttgcgtggtgcgaaa
gtggcagcgaatacaattaaaccagatttggcgatagctgtcgatgtaggtattgcttat
gataccccaggtatgtcaggtcaaacgagcgatagtaaactaggcggtggtccagttgtc
attatgatggatgctacaagtattgctcaccaaggtttgcgtaagcatattaaagatgta
gctaaggaacataacatcgaagtacaatgggatacgacaccaggtggaggtacagatgcg
ggaagtattcatgtcgcaaatgaaggtattccaacgatgacaatcggtgttacgctgcga
tacatgcattctaatgtttcagtgctcaatgtagatgattatgaaaattctatccgtctt
gttactgaaattgtccgttcattgaatgatgaaagttataaaaatatcatgtggtaa

DBGET integrated database retrieval system