KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA): SaurJH9_2650Help
Entry
SaurJH9_2650      CDS       T00522                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:saj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SaurJH9_2650
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SaurJH9_2650
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SaurJH9_2650
Enzymes [BR:saj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SaurJH9_2650
Exosome [BR:saj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SaurJH9_2650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2806952..2808376
Genome map
AA seq 474 aa AA seqDB search
MLSVKKATKFAVANLIIVSTVFSSVTPAIAQSDKSSKDESFAVGNTKNPKNVIFLVGDGM
GPSFNTAYRYYKNDSHAKEMTPTAFDSYLKGTNRTYSNDPKQNITDSAAGGTAFSSGHKT
YNGAIGVDSNKQKVKTVLERAKEKGKSTGLVSTAELTDATPAAYAAHVTSRDDKNEIAKQ
FYKDKINGKHKVDVLLGGGAKYFGKSNGNLDKKFKKDGYDLATNSKDLSKSDKDKVLGLF
ADKNMPLAIDASKDEPSLADMQQSALSKLERNKKGFFLMVEGASIDKSAHSNDITGVMSE
MEGFEKAFDDAIQYAKKHKDTLVVATADHSTGGLTIGKDKGYEWNPQPIKSMKHSGSYMT
EKMAKGEDPEKVINEGYGFEFSQDDMKKVKKENKKLQKLLKKEKDEKSADVEKQTKALQH
AIQKPVNDKSYTGWTSDGHTGEDVNTYAYGPRSESFSGNIENTESAKIIFDIFK
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgttatcagttaaaaaagccacaaaatttgcagttgctaaccttattatcgtgtcaaca
gttttcagttctgtcacacctgcaattgcgcaatccgataaaagttctaaagatgaaagt
ttcgcagttggtaatactaaaaatccaaaaaatgttatctttttagttggcgatggcatg
ggtccatcatttaacacagcttatcgttattataaaaatgattcgcatgccaaagaaatg
acccctactgcttttgattcatatttaaaaggcacaaatcgtacatattcaaatgaccca
aaacagaatattactgattctgcagctggcggaacagcctttagttctggccataagaca
tataatggtgccatcggtgttgacagtaacaagcagaaagtaaagacagtgcttgaacgt
gcaaaagaaaaaggtaagtcgactggtcttgtttcaacagctgaattaacagatgcaaca
ccagcagcatatgctgcacacgtgacttctagagatgataaaaacgaaatcgctaaacaa
ttttataaagataaaatcaacggaaagcataaagttgatgttttattaggcggcggcgct
aaatatttcggtaaaagtaatggcaatttagataaaaaattcaaaaaagatggttacgac
cttgccacgaacagtaaggatttatcaaaatctgataaagataaagttcttggtttgttt
gcagataaaaatatgccacttgcaatagatgcttctaaagacgaaccatcattagctgat
atgcaacaaagtgcacttagtaagcttgagcgtaataaaaaaggtttctttttaatggtc
gaaggtgcttctatagataaatcagcgcattccaacgatattacaggcgttatgtctgaa
atggaaggttttgaaaaagcattcgatgacgccattcaatatgctaagaaacataaagat
acacttgtcgttgcaacagcagatcactctactggtggtctaacaattggtaaagataaa
ggatacgaatggaatcctcaaccgattaaatcgatgaaacactctggatcatatatgaca
gaaaaaatggctaaaggtgaagaccctgaaaaagttattaatgaaggttatggctttgaa
ttttcacaagatgatatgaaaaaggttaaaaaagagaataaaaagttgcaaaaattactt
aaaaaagaaaaagacgaaaaatctgcagatgtagaaaaacaaacaaaagccttacaacac
gcaattcagaagccagtaaatgataaatcttatacagggtggacttccgatggacataca
ggcgaggatgttaatacctacgcttacggacctagatcagaatcatttagtggtaatatc
gaaaatacagaaagcgcaaaaataatatttgatatattcaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system