KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA): SaurJH9_2702Help
Entry
SaurJH9_2702      CDS       T00522                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA)
Pathway
saj00340  Histidine metabolism
saj01100  Metabolic pathways
saj01110  Biosynthesis of secondary metabolites
saj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saj00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SaurJH9_2702
Enzymes [BR:saj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SaurJH9_2702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh HALZ DUF4435 MbeB_N DUF2064 DUF883 FadA
Motif
Other DBs
NCBI-ProteinID: ABQ50478
JGI: SaurJH92702
Position
complement(2873553..2874803)
Genome map
AA seq 416 aa AA seqDB search
MLNAQQFLNQFSLEAPLDESLYPIIRDICQEVKVHGDKALKMYNLTFDHTKTDHLEISHE
QIKAAFDTLDEKTKQALQQSYERIKAYQESIKQTNQQLEESVECYEIYHPLESVGIYVPG
GKASYPSTVLMTATLAQVAGVENIVVVTPPQPNGVSQEVLAACYITQVNQVFQVGGAQSI
AALTYGTETIPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPTEIALIIDDTADLDAIV
YDVFAQAEHDELARTYVIGEDAQVLKDLESRIAKALPNVDRYDIVSKSIANQHYLIHASN
FDEACHVMNTIAPEHASIQTVNPQPYIEKVKYVGALFIGHYSPEVIGDYVAGPSHVLPTN
RTARFTNGLSVNDFLTRNTVIHLSKDTFEQIADSAQHIAHVEALYNHQQSILIRQS
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgcacaacaatttttaaatcaattttcattagaagcaccattagatgagtca
ttgtatccaattattcgcgatatttgtcaggaagttaaagttcatggagataaggctttg
aaaatgtataatctaacattcgatcatacgaaaacagatcatttagaaattagtcatgaa
caaattaaagcagcatttgacacattagatgaaaaaacaaaacaagcattacaacaaagt
tatgaaagaattaaagcatatcaagaaagtattaagcagacgaatcaacagttagaagaa
tcagtggagtgttatgaaatataccatccactagaaagtgtgggtatttatgtgcctggt
ggcaaagcaagttatccatcaacggttctaatgacagcgactttagcacaagtagcgggt
gtagaaaatattgttgttgtgacaccacctcaacctaacggagtatcccaagaggtatta
gctgcatgttatattacgcaagttaatcaagtgtttcaagttggtggtgctcaaagtatt
gctgcattgacttatggaacagaaacgatacctaaagttgataagattgtaggtccaggt
aaccaatttgttgcatatgccaaaaaatatttatttggacaggtaggtattgatcaaatt
gcaggaccaacagaaatagcactgattattgacgacaccgcagatttagatgccatcgta
tatgatgtatttgcgcaagcagaacatgatgaattagcacgtacatatgtcattggtgaa
gatgcgcaagtccttaaagatttagaatcacgtattgctaaagcattgcctaatgtggac
agatacgacattgtttctaaaagtatcgctaatcaacactaccttatccatgctagtaat
tttgatgaagcatgccatgtcatgaatacaatcgcgcctgaacatgcgtcgattcaaaca
gtaaatcctcaaccatatattgaaaaagtgaaatatgtgggtgcattgtttattggacat
tattcgccagaggtcataggagattacgttgcaggtccaagtcatgtattacctacaaat
agaacagctagatttaccaatgggttatcggtcaatgatttcttaacacggaacacggtc
atccatttatcaaaagatacgtttgaacaaattgctgattcagcacaacatattgctcat
gttgaagcattatacaatcaccagcagtctattttaatacgtcagtcttag

DBGET integrated database retrieval system